Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	newbase	is_coding	is_flank	is_indel	is_ins	is_del	is_missense	is_nonsense	is_splice	is_silent	context_orig	context65	categ	categ_ignoring_null_categ	gene_idx	pat_idx
AGMAT	79814	broad.mit.edu	37	1	15904246	15904246	+	Silent	SNP	G	A	A	rs148750290	by1000genomes	TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:15904246G>A	uc001awv.1	-	5	977	c.834C>T	c.(832-834)GAC>GAT	p.D278D	DNAJC16_uc001awu.2_Intron	NM_024758	NP_079034	Q9BSE5	SPEB_HUMAN	agmatine ureohydrolase (agmatinase) precursor	278		Manganese 2 (By similarity).			putrescine biosynthetic process|spermidine biosynthetic process	mitochondrion	agmatinase activity|metal ion binding			skin(1)	1		Breast(348;0.000207)|Colorectal(325;0.000258)|Lung NSC(340;0.000359)|all_lung(284;0.000486)|Renal(390;0.000518)|Ovarian(437;0.0129)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0228)|Colorectal(212;6.93e-07)|COAD - Colon adenocarcinoma(227;3.91e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000121)|KIRC - Kidney renal clear cell carcinoma(229;0.00257)|STAD - Stomach adenocarcinoma(313;0.00734)|READ - Rectum adenocarcinoma(331;0.0649)		GATCCAGAGCGTCAATATCAA	0.532													33	58	---	---	---	---	capture	Silent	SNP	15904246	15904246	AGMAT	1	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	385	190
EPHA8	2046	broad.mit.edu	37	1	22924647	22924647	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:22924647G>A	uc001bfx.1	+	12	2245	c.2120G>A	c.(2119-2121)CGC>CAC	p.R707H		NM_020526	NP_065387	P29322	EPHA8_HUMAN	ephrin receptor EphA8 isoform 1 precursor	707	Cytoplasmic (Potential).|Protein kinase.					integral to plasma membrane	ATP binding|ephrin receptor activity			central_nervous_system(5)|breast(3)|lung(2)|large_intestine(1)|stomach(1)|skin(1)	13		Colorectal(325;3.46e-05)|Lung NSC(340;6.55e-05)|all_lung(284;9.87e-05)|Renal(390;0.000219)|Breast(348;0.00222)|Ovarian(437;0.00308)|Myeloproliferative disorder(586;0.0255)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0227)|OV - Ovarian serous cystadenocarcinoma(117;7.29e-27)|Colorectal(126;1.61e-07)|COAD - Colon adenocarcinoma(152;1.14e-05)|GBM - Glioblastoma multiforme(114;1.74e-05)|BRCA - Breast invasive adenocarcinoma(304;0.000554)|KIRC - Kidney renal clear cell carcinoma(1967;0.00272)|STAD - Stomach adenocarcinoma(196;0.00644)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.199)		CGCCCAGGCCGCCTGGCAATG	0.622													53	104	---	---	---	---	capture	Missense_Mutation	SNP	22924647	22924647	EPHA8	1	G	A	A	A	1	0	0	0	0	1	0	0	0	494	38	1	1	5128	190
HTR1D	3352	broad.mit.edu	37	1	23520071	23520071	+	Silent	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:23520071G>A	uc001bgn.2	-	1	1152	c.642C>T	c.(640-642)ATC>ATT	p.I214I		NM_000864	NP_000855	P28221	5HT1D_HUMAN	5-hydroxytryptamine (serotonin) receptor 1D	214	Helical; Name=5; (By similarity).				G-protein signaling, coupled to cyclic nucleotide second messenger|intestine smooth muscle contraction|synaptic transmission	integral to plasma membrane	serotonin receptor activity				0		Colorectal(325;0.000147)|Renal(390;0.000734)|Lung NSC(340;0.000779)|all_lung(284;0.00135)|Breast(348;0.0385)|Myeloproliferative disorder(586;0.0393)|Ovarian(437;0.0561)		UCEC - Uterine corpus endometrioid carcinoma (279;0.0227)|OV - Ovarian serous cystadenocarcinoma(117;4.69e-27)|Colorectal(126;4.86e-08)|COAD - Colon adenocarcinoma(152;2.86e-06)|GBM - Glioblastoma multiforme(114;0.00012)|BRCA - Breast invasive adenocarcinoma(304;0.000949)|KIRC - Kidney renal clear cell carcinoma(1967;0.00122)|STAD - Stomach adenocarcinoma(196;0.0123)|READ - Rectum adenocarcinoma(331;0.0649)|Lung(427;0.083)|LUSC - Lung squamous cell carcinoma(448;0.185)	Almotriptan(DB00918)|Dihydroergotamine(DB00320)|Eletriptan(DB00216)|Ergotamine(DB00696)|Frovatriptan(DB00998)|Naratriptan(DB00952)|Rizatriptan(DB00953)|Sumatriptan(DB00669)|Tegaserod(DB01079)|Ziprasidone(DB00246)|Zolmitriptan(DB00315)	CATATAGGATGATGAGCAACA	0.577													28	42	---	---	---	---	capture	Silent	SNP	23520071	23520071	HTR1D	1	G	A	A	A	1	0	0	0	0	0	0	0	1	577	45	2	2	7363	190
KLHDC9	126823	broad.mit.edu	37	1	161068632	161068632	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:161068632C>T	uc001fxr.2	+	1	479	c.307C>T	c.(307-309)CGC>TGC	p.R103C	KLHDC9_uc001fxq.2_5'UTR|KLHDC9_uc001fxs.2_Missense_Mutation_p.R103C	NM_152366	NP_689579	Q8NEP7	KLDC9_HUMAN	kelch/ankyrin repeat containing cyclin A1	103	Kelch 2.										0	all_cancers(52;1.28e-19)|Breast(13;0.00188)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00165)			CGGGTCTCGCCGCTTGGCCAC	0.726													2	2	---	---	---	---	capture	Missense_Mutation	SNP	161068632	161068632	KLHDC9	1	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	8284	190
ADAMTS4	9507	broad.mit.edu	37	1	161165991	161165991	+	Missense_Mutation	SNP	G	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:161165991G>T	uc001fyt.3	-	3	1488	c.1060C>A	c.(1060-1062)CAG>AAG	p.Q354K	ADAMTS4_uc001fyu.2_3'UTR	NM_005099	NP_005090	O75173	ATS4_HUMAN	ADAM metallopeptidase with thrombospondin type 1	354	Peptidase M12B.				proteolysis|skeletal system development	extracellular space|proteinaceous extracellular matrix	metalloendopeptidase activity|protease binding|zinc ion binding			ovary(4)|central_nervous_system(1)	5	all_cancers(52;3.73e-19)|Breast(13;0.000577)|all_hematologic(112;0.093)		BRCA - Breast invasive adenocarcinoma(70;0.00275)			AAGGCTGACTGGAGCCCATCA	0.577													11	112	---	---	---	---	capture	Missense_Mutation	SNP	161165991	161165991	ADAMTS4	1	G	T	T	T	1	0	0	0	0	1	0	0	0	611	47	4	4	268	190
SLC9A11	284525	broad.mit.edu	37	1	173552735	173552735	+	Missense_Mutation	SNP	T	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:173552735T>A	uc001giz.2	-	6	973	c.550A>T	c.(550-552)ATT>TTT	p.I184F	SLC9A11_uc010pmq.1_RNA	NM_178527	NP_848622	Q5TAH2	S9A11_HUMAN	solute carrier family 9, member 11	184	Helical; (Potential).				sodium ion transport	integral to membrane	ion channel activity|solute:hydrogen antiporter activity			ovary(2)	2						TCTCCTCTAATGAGATCAATG	0.294													44	86	---	---	---	---	capture	Missense_Mutation	SNP	173552735	173552735	SLC9A11	1	T	A	A	A	1	0	0	0	0	1	0	0	0	663	51	4	4	14603	190
PHLDA3	23612	broad.mit.edu	37	1	201437745	201437745	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:201437745C>T	uc001gwq.2	-	1	555	c.170G>A	c.(169-171)CGC>CAC	p.R57H	PHLDA3_uc009wzx.2_5'UTR	NM_012396	NP_036528	Q9Y5J5	PHLA3_HUMAN	pleckstrin homology-like domain, family A,	57	PH.				anatomical structure morphogenesis|apoptosis|DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis|negative regulation of protein kinase B signaling cascade	cytoplasm|intracellular membrane-bounded organelle|plasma membrane	identical protein binding|phosphatidylinositol-3,4,5-trisphosphate binding|phosphatidylinositol-3,4-bisphosphate binding|phosphatidylinositol-3,5-bisphosphate binding|phosphatidylinositol-3-phosphate binding|phosphatidylinositol-4,5-bisphosphate binding|phosphatidylinositol-5-phosphate binding				0						GGCCTTGATGCGGGCGAAGCT	0.687													4	89	---	---	---	---	capture	Missense_Mutation	SNP	201437745	201437745	PHLDA3	1	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	11753	190
KDM5B	10765	broad.mit.edu	37	1	202718129	202718129	+	Missense_Mutation	SNP	C	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:202718129C>A	uc001gyf.2	-	14	2076	c.1960G>T	c.(1960-1962)GAC>TAC	p.D654Y	KDM5B_uc009xag.2_Missense_Mutation_p.D690Y|KDM5B_uc001gyg.1_Missense_Mutation_p.D496Y	NM_006618	NP_006609	Q9UGL1	KDM5B_HUMAN	jumonji, AT rich interactive domain 1B	654					negative regulation of transcription, DNA-dependent	nucleolus	DNA binding|histone demethylase activity (H3-dimethyl-K4 specific)|histone demethylase activity (H3-trimethyl-K4 specific)|oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen|protein binding|sequence-specific DNA binding transcription factor activity|transcription corepressor activity|zinc ion binding			ovary(2)|breast(2)|urinary_tract(1)	5						ATGGCCATGTCTTTCTGAACA	0.403													4	125	---	---	---	---	capture	Missense_Mutation	SNP	202718129	202718129	KDM5B	1	C	A	A	A	1	0	0	0	0	1	0	0	0	416	32	4	4	8056	190
USH2A	7399	broad.mit.edu	37	1	215972257	215972257	+	Missense_Mutation	SNP	C	T	T	rs140746096		TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:215972257C>T	uc001hku.1	-	50	10337	c.9950G>A	c.(9949-9951)CGC>CAC	p.R3317H		NM_206933	NP_996816	O75445	USH2A_HUMAN	usherin isoform B	3317	Extracellular (Potential).				maintenance of organ identity|photoreceptor cell maintenance|response to stimulus|sensory perception of sound	basement membrane|cytoplasm|integral to membrane|stereocilium membrane	collagen binding			ovary(20)|upper_aerodigestive_tract(2)|skin(2)|kidney(1)|central_nervous_system(1)	26				OV - Ovarian serous cystadenocarcinoma(81;0.0547)|all cancers(67;0.0875)		ACCTGGAAGGCGATTGTACAC	0.473										HNSCC(13;0.011)			50	103	---	---	---	---	capture	Missense_Mutation	SNP	215972257	215972257	USH2A	1	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	16918	190
C1orf65	164127	broad.mit.edu	37	1	223568231	223568231	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:223568231C>T	uc001hoa.2	+	1	1517	c.1414C>T	c.(1414-1416)CGC>TGC	p.R472C		NM_152610	NP_689823	Q8N715	CA065_HUMAN	hypothetical protein LOC164127	472	Potential.									central_nervous_system(1)|skin(1)	2				GBM - Glioblastoma multiforme(131;0.0704)		GGAGCGGCAACGCGAGCTGAG	0.607													24	37	---	---	---	---	capture	Missense_Mutation	SNP	223568231	223568231	C1orf65	1	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	2037	190
RYR2	6262	broad.mit.edu	37	1	237863751	237863751	+	Silent	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:237863751C>T	uc001hyl.1	+	65	9471	c.9351C>T	c.(9349-9351)TTC>TTT	p.F3117F	RYR2_uc010pxz.1_Silent_p.F72F	NM_001035	NP_001026	Q92736	RYR2_HUMAN	cardiac muscle ryanodine receptor	3117					cardiac muscle contraction|detection of calcium ion|induction of apoptosis by ionic changes|regulation of cardiac muscle contraction by regulation of the release of sequestered calcium ion|release of sequestered calcium ion into cytosol by sarcoplasmic reticulum|response to caffeine|response to hypoxia|response to redox state	calcium channel complex|cytosol|plasma membrane|plasma membrane enriched fraction|sarcoplasmic reticulum membrane	calcium ion binding|calmodulin binding|identical protein binding|protein kinase A catalytic subunit binding|protein kinase A regulatory subunit binding|receptor activity|ryanodine-sensitive calcium-release channel activity|suramin binding			ovary(17)|large_intestine(6)|central_nervous_system(6)|pancreas(3)|breast(1)	33	Ovarian(103;0.103)	all_cancers(173;0.000368)|Melanoma(53;0.0179)|all_epithelial(177;0.0225)	OV - Ovarian serous cystadenocarcinoma(106;0.00606)			AGCATCAGTTCGGAGAAGACC	0.373													5	13	---	---	---	---	capture	Silent	SNP	237863751	237863751	RYR2	1	C	T	T	T	1	0	0	0	0	0	0	0	1	402	31	1	1	13661	190
NLRP3	114548	broad.mit.edu	37	1	247587925	247587925	+	Missense_Mutation	SNP	G	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:247587925G>T	uc001icr.2	+	5	1318	c.1180G>T	c.(1180-1182)GCA>TCA	p.A394S	NLRP3_uc001ics.2_Missense_Mutation_p.A394S|NLRP3_uc001icu.2_Missense_Mutation_p.A394S|NLRP3_uc001icw.2_Missense_Mutation_p.A394S|NLRP3_uc001icv.2_Missense_Mutation_p.A394S|NLRP3_uc010pyw.1_Missense_Mutation_p.A392S|NLRP3_uc001ict.1_Missense_Mutation_p.A392S	NM_001079821	NP_001073289	Q96P20	NALP3_HUMAN	NLR family, pyrin domain containing 3 isoform a	394	NACHT.				detection of biotic stimulus|induction of apoptosis|inflammatory response|negative regulation of NF-kappaB import into nucleus|negative regulation of NF-kappaB transcription factor activity|positive regulation of interleukin-1 beta secretion|protein oligomerization|signal transduction	cytoplasm	ATP binding|peptidoglycan binding|protein binding			lung(8)|skin(8)|ovary(7)|upper_aerodigestive_tract(1)|breast(1)|pancreas(1)	26	all_cancers(71;9.66e-05)|all_epithelial(71;1.85e-05)|Breast(184;0.0226)|Ovarian(71;0.0377)|all_lung(81;0.0662)|Lung NSC(105;0.0724)	all_cancers(173;0.0172)	OV - Ovarian serous cystadenocarcinoma(106;0.0141)			CCAAGCCAGGGCAGCCTTCAG	0.537													33	70	---	---	---	---	capture	Missense_Mutation	SNP	247587925	247587925	NLRP3	1	G	T	T	T	1	0	0	0	0	1	0	0	0	546	42	4	4	10385	190
OIT3	170392	broad.mit.edu	37	10	74666378	74666378	+	Missense_Mutation	SNP	A	G	G			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr10:74666378A>G	uc001jte.1	+	4	787	c.569A>G	c.(568-570)AAC>AGC	p.N190S	OIT3_uc009xqs.1_RNA	NM_152635	NP_689848	Q8WWZ8	OIT3_HUMAN	oncoprotein-induced transcript 3 precursor	190	EGF-like; calcium-binding (Potential).					nuclear envelope	calcium ion binding			ovary(2)	2	Prostate(51;0.0198)					GAGCAAAACAACGGTGGCTGC	0.488													80	150	---	---	---	---	capture	Missense_Mutation	SNP	74666378	74666378	OIT3	10	A	G	G	G	1	0	0	0	0	1	0	0	0	26	2	3	3	10754	190
EBF3	253738	broad.mit.edu	37	10	131640486	131640486	+	Missense_Mutation	SNP	G	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr10:131640486G>C	uc001lki.1	-	13	1298	c.1239C>G	c.(1237-1239)ATC>ATG	p.I413M		NM_001005463	NP_001005463	Q9H4W6	COE3_HUMAN	early B-cell factor 3	422					multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|metal ion binding|protein binding			central_nervous_system(1)|pancreas(1)	2		all_cancers(35;1.8e-08)|all_epithelial(44;8.26e-08)|Lung NSC(174;0.0091)|all_lung(145;0.0123)|Breast(234;0.039)|all_neural(114;0.0722)|Colorectal(57;0.0764)		OV - Ovarian serous cystadenocarcinoma(35;0.00513)		CCAGGGTGGGGATCTGGTTGT	0.617													58	151	---	---	---	---	capture	Missense_Mutation	SNP	131640486	131640486	EBF3	10	G	C	C	C	1	0	0	0	0	1	0	0	0	525	41	4	4	4837	190
OR52J3	119679	broad.mit.edu	37	11	5068212	5068212	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:5068212C>T	uc010qyv.1	+	1	457	c.457C>T	c.(457-459)CGT>TGT	p.R153C		NM_001001916	NP_001001916	Q8NH60	O52J3_HUMAN	olfactory receptor, family 52, subfamily J,	153	Helical; Name=4; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|lung(1)|skin(1)	3		Medulloblastoma(188;0.00131)|all_neural(188;0.0189)|Breast(177;0.0204)		Epithelial(150;9.29e-10)|BRCA - Breast invasive adenocarcinoma(625;0.135)|LUSC - Lung squamous cell carcinoma(625;0.19)		CATTGTAATTCGTCCCGTTTT	0.468													45	72	---	---	---	---	capture	Missense_Mutation	SNP	5068212	5068212	OR52J3	11	C	T	T	T	1	0	0	0	0	1	0	0	0	403	31	1	1	11026	190
SLC5A12	159963	broad.mit.edu	37	11	26718717	26718717	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:26718717G>A	uc001mra.2	-	8	1347	c.1034C>T	c.(1033-1035)ACT>ATT	p.T345I	SLC5A12_uc001mrb.2_RNA|SLC5A12_uc001mrc.3_Missense_Mutation_p.T345I	NM_178498	NP_848593	Q1EHB4	SC5AC_HUMAN	solute carrier family 5 (sodium/glucose	345	Cytoplasmic (Potential).				sodium ion transport	apical plasma membrane|integral to membrane	symporter activity			ovary(1)|skin(1)	2						TAACCTCAGAGTTCCACTGAA	0.373													4	119	---	---	---	---	capture	Missense_Mutation	SNP	26718717	26718717	SLC5A12	11	G	A	A	A	1	0	0	0	0	1	0	0	0	468	36	2	2	14556	190
PYGM	5837	broad.mit.edu	37	11	64521011	64521011	+	Silent	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:64521011G>A	uc001oax.3	-	11	2200	c.1383C>T	c.(1381-1383)TCC>TCT	p.S461S	PYGM_uc001oay.3_Silent_p.S373S	NM_005609	NP_005600	P11217	PYGM_HUMAN	muscle glycogen phosphorylase isoform 1	461					glucose metabolic process|glycogen catabolic process	cytosol	glycogen phosphorylase activity|protein binding			ovary(2)	2					Pyridoxal Phosphate(DB00114)	TGAGGATCTCGGAGTGGATGC	0.652													3	11	---	---	---	---	capture	Silent	SNP	64521011	64521011	PYGM	11	G	A	A	A	1	0	0	0	0	0	0	0	1	496	39	1	1	12757	190
GPR83	10888	broad.mit.edu	37	11	94113625	94113625	+	Missense_Mutation	SNP	C	T	T	rs145628763	byFrequency	TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:94113625C>T	uc001pet.2	-	4	1134	c.962G>A	c.(961-963)CGC>CAC	p.R321H		NM_016540	NP_057624	Q9NYM4	GPR83_HUMAN	G protein-coupled receptor 83 precursor	321	Extracellular (Potential).					integral to membrane|plasma membrane	neuropeptide Y receptor activity			central_nervous_system(2)|ovary(1)	3		Acute lymphoblastic leukemia(157;2.26e-05)|all_hematologic(158;0.0123)				ATTGTTGGTGCGGATGACCTT	0.517													75	128	---	---	---	---	capture	Missense_Mutation	SNP	94113625	94113625	GPR83	11	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	6646	190
KIAA1377	57562	broad.mit.edu	37	11	101793446	101793446	+	Missense_Mutation	SNP	G	A	A	rs142032267		TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:101793446G>A	uc001pgm.2	+	2	473	c.203G>A	c.(202-204)CGA>CAA	p.R68Q	KIAA1377_uc001pgn.2_Missense_Mutation_p.R24Q	NM_020802	NP_065853	Q9P2H0	K1377_HUMAN	hypothetical protein LOC57562	68	Potential.						protein binding	p.R68*(1)		breast(2)|ovary(1)|central_nervous_system(1)	4	all_epithelial(12;0.0104)	Acute lymphoblastic leukemia(157;0.000967)|all_hematologic(158;0.00931)		BRCA - Breast invasive adenocarcinoma(274;0.038)		AAAATATGTCGAAATCGAGCA	0.303													28	58	---	---	---	---	capture	Missense_Mutation	SNP	101793446	101793446	KIAA1377	11	G	A	A	A	1	0	0	0	0	1	0	0	0	481	37	1	1	8149	190
GRIN2B	2904	broad.mit.edu	37	12	13716353	13716353	+	Silent	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:13716353C>T	uc001rbt.2	-	13	3998	c.3819G>A	c.(3817-3819)ACG>ACA	p.T1273T		NM_000834	NP_000825	Q13224	NMDE2_HUMAN	N-methyl-D-aspartate receptor subunit 2B	1273	Cytoplasmic (Potential).				response to ethanol	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic membrane	glycine binding|N-methyl-D-aspartate selective glutamate receptor activity|zinc ion binding			central_nervous_system(4)|ovary(3)|skin(3)|lung(2)	12					Felbamate(DB00949)|Haloperidol(DB00502)|L-Glutamic Acid(DB00142)|Loperamide(DB00836)|Memantine(DB01043)	AGGCGTTTGACGTCACCGCCA	0.582													16	41	---	---	---	---	capture	Silent	SNP	13716353	13716353	GRIN2B	12	C	T	T	T	1	0	0	0	0	0	0	0	1	236	19	1	1	6713	190
EPYC	1833	broad.mit.edu	37	12	91363838	91363838	+	Nonsense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:91363838G>A	uc001tbk.2	-	6	874	c.781C>T	c.(781-783)CGA>TGA	p.R261*		NM_004950	NP_004941	Q99645	EPYC_HUMAN	dermatan sulfate proteoglycan 3 precursor	261	LRR 5.				female pregnancy	proteinaceous extracellular matrix	glycosaminoglycan binding			skin(1)	1						TGAAGGGCTCGTAGATTTTCT	0.478													84	166	---	---	---	---	capture	Nonsense_Mutation	SNP	91363838	91363838	EPYC	12	G	A	A	A	1	0	0	0	0	0	1	0	0	519	40	5	1	5156	190
NR1H4	9971	broad.mit.edu	37	12	100897255	100897255	+	Missense_Mutation	SNP	G	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:100897255G>T	uc001tht.1	+	1	118	c.90G>T	c.(88-90)ATG>ATT	p.M30I	NR1H4_uc001thp.1_Intron|NR1H4_uc001thq.1_Intron|NR1H4_uc010svj.1_Intron|NR1H4_uc001thr.1_Intron|NR1H4_uc010svk.1_Intron|NR1H4_uc001ths.1_Missense_Mutation_p.M30I	NM_005123	NP_005114	Q96RI1	NR1H4_HUMAN	nuclear receptor subfamily 1, group H, member 4	30					bile acid metabolic process|regulation of transcription from RNA polymerase II promoter by nuclear hormone receptor	nucleoplasm	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|steroid hormone receptor activity|thyroid hormone receptor activity|transcription coactivator activity|transcription corepressor activity|zinc ion binding			ovary(1)|lung(1)|skin(1)	3						TGGAAATGATGAGTATGAAGC	0.453													12	27	---	---	---	---	capture	Missense_Mutation	SNP	100897255	100897255	NR1H4	12	G	T	T	T	1	0	0	0	0	1	0	0	0	573	45	4	4	10526	190
DAO	1610	broad.mit.edu	37	12	109293186	109293186	+	Missense_Mutation	SNP	C	T	T	rs140015394		TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:109293186C>T	uc001tnr.3	+	10	1000	c.847C>T	c.(847-849)CGG>TGG	p.R283W	DAO_uc001tnq.3_Missense_Mutation_p.R217W|DAO_uc009zvb.2_RNA|DAO_uc001tns.3_RNA	NM_001917	NP_001908	P14920	OXDA_HUMAN	D-amino-acid oxidase	283		Substrate.			glyoxylate metabolic process	peroxisomal matrix	binding|D-amino-acid oxidase activity			ovary(1)|skin(1)	2						AACTGGCTTCCGGCCAGTACG	0.458													11	29	---	---	---	---	capture	Missense_Mutation	SNP	109293186	109293186	DAO	12	C	T	T	T	1	0	0	0	0	1	0	0	0	295	23	1	1	4190	190
RPGRIP1	57096	broad.mit.edu	37	14	21793505	21793505	+	Missense_Mutation	SNP	C	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr14:21793505C>A	uc001wag.2	+	15	2330	c.2330C>A	c.(2329-2331)ACC>AAC	p.T777N	RPGRIP1_uc001wah.2_Missense_Mutation_p.T419N|RPGRIP1_uc001wai.2_Intron|RPGRIP1_uc001wak.2_Missense_Mutation_p.T252N|RPGRIP1_uc010aim.2_Missense_Mutation_p.T160N|RPGRIP1_uc001wal.2_Missense_Mutation_p.T136N|RPGRIP1_uc001wam.2_Missense_Mutation_p.T94N	NM_020366	NP_065099	Q96KN7	RPGR1_HUMAN	retinitis pigmentosa GTPase regulator	777					response to stimulus|visual perception	cilium				ovary(4)|breast(2)|pancreas(1)	7	all_cancers(95;0.0017)	all_cancers(140;0.0973)	Epithelial(56;6.24e-07)|all cancers(55;6.56e-06)	GBM - Glioblastoma multiforme(265;0.00888)		TACCTGTCAACCGATGTGCTT	0.542													16	13	---	---	---	---	capture	Missense_Mutation	SNP	21793505	21793505	RPGRIP1	14	C	A	A	A	1	0	0	0	0	1	0	0	0	234	18	4	4	13441	190
LOXL1	4016	broad.mit.edu	37	15	74238821	74238821	+	Silent	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr15:74238821C>T	uc002awc.1	+	3	1611	c.1275C>T	c.(1273-1275)CGC>CGT	p.R425R	LOXL1_uc002awd.1_5'Flank	NM_005576	NP_005567	Q08397	LOXL1_HUMAN	lysyl oxidase-like 1 preproprotein	425	Lysyl-oxidase like.				protein deamination	extracellular space	copper ion binding				0						TCCCCCAGCGCGTGAAGAACC	0.692													13	12	---	---	---	---	capture	Silent	SNP	74238821	74238821	LOXL1	15	C	T	T	T	1	0	0	0	0	0	0	0	1	340	27	1	1	8815	190
USP6	9098	broad.mit.edu	37	17	5050405	5050405	+	Nonsense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:5050405C>T	uc002gau.1	+	29	4577	c.2347C>T	c.(2347-2349)CAA>TAA	p.Q783*	USP6_uc002gav.1_Nonsense_Mutation_p.Q783*|USP6_uc010ckz.1_Nonsense_Mutation_p.Q466*	NM_004505	NP_004496	P35125	UBP6_HUMAN	ubiquitin specific protease 6	783					protein deubiquitination|regulation of vesicle-mediated transport|ubiquitin-dependent protein catabolic process	lysosome|plasma membrane|recycling endosome	calmodulin binding|cysteine-type endopeptidase activity|nucleic acid binding|protein binding|Rab GTPase activator activity|ubiquitin thiolesterase activity|ubiquitin-specific protease activity			skin(2)|upper_aerodigestive_tract(1)|lung(1)|breast(1)	5						CCAAAAAGTACAACTCTCAGT	0.383			T	COL1A1|CDH11|ZNF9|OMD	aneurysmal bone cysts								15	160	---	---	---	---	capture	Nonsense_Mutation	SNP	5050405	5050405	USP6	17	C	T	T	T	1	0	0	0	0	0	1	0	0	221	17	5	2	16968	190
MYO1D	4642	broad.mit.edu	37	17	31105570	31105570	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:31105570G>A	uc002hho.1	-	3	338	c.326C>T	c.(325-327)ACG>ATG	p.T109M	MYO1D_uc002hhp.1_Missense_Mutation_p.T109M|MYO1D_uc010wcb.1_Missense_Mutation_p.T109M	NM_015194	NP_056009	O94832	MYO1D_HUMAN	myosin ID	109	ATP (Potential).|Myosin head-like.					myosin complex	actin binding|ATP binding|calmodulin binding			large_intestine(1)|ovary(1)|central_nervous_system(1)	3			BRCA - Breast invasive adenocarcinoma(9;0.0362)			ACTGGCTTCCGTTTTACCAGC	0.393													37	79	---	---	---	---	capture	Missense_Mutation	SNP	31105570	31105570	MYO1D	17	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	9981	190
MYO19	80179	broad.mit.edu	37	17	34856982	34856982	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:34856982G>A	uc010wcy.1	-	23	3166	c.2174C>T	c.(2173-2175)ACT>ATT	p.T725I	MYO19_uc002hmw.2_Missense_Mutation_p.T525I|MYO19_uc010cuu.2_RNA	NM_001163735	NP_001157207	Q96H55	MYO19_HUMAN	myosin XIX isoform 2	725						mitochondrial outer membrane|myosin complex	actin binding|ATP binding|motor activity			ovary(1)	1		Breast(25;0.00957)|Ovarian(249;0.17)	Kidney(155;0.104)	UCEC - Uterine corpus endometrioid carcinoma (308;0.0185)		CGAGTCACCAGTTATGGCTGC	0.577													5	170	---	---	---	---	capture	Missense_Mutation	SNP	34856982	34856982	MYO19	17	G	A	A	A	1	0	0	0	0	1	0	0	0	468	36	2	2	9977	190
TANC2	26115	broad.mit.edu	37	17	61428697	61428697	+	Missense_Mutation	SNP	A	G	G			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:61428697A>G	uc002jal.3	+	11	1695	c.1672A>G	c.(1672-1674)ATT>GTT	p.I558V	TANC2_uc010wpe.1_Missense_Mutation_p.I468V	NM_025185	NP_079461	Q9HCD6	TANC2_HUMAN	tetratricopeptide repeat, ankyrin repeat and	558							binding			ovary(2)	2						TGGGGATACAATTGTATCGTT	0.338													54	84	---	---	---	---	capture	Missense_Mutation	SNP	61428697	61428697	TANC2	17	A	G	G	G	1	0	0	0	0	1	0	0	0	52	4	3	3	15433	190
PTPRM	5797	broad.mit.edu	37	18	7888125	7888125	+	Missense_Mutation	SNP	C	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr18:7888125C>A	uc002knn.3	+	3	721	c.218C>A	c.(217-219)GCC>GAC	p.A73D	PTPRM_uc010dkv.2_Missense_Mutation_p.A73D	NM_002845	NP_002836	P28827	PTPRM_HUMAN	protein tyrosine phosphatase, receptor type, M	73	MAM.|Extracellular (Potential).				homophilic cell adhesion|negative regulation of angiogenesis|negative regulation of endothelial cell migration|negative regulation of endothelial cell proliferation|response to drug|retina layer formation|retinal ganglion cell axon guidance	cell-cell adherens junction|integral to plasma membrane|lamellipodium|perinuclear region of cytoplasm	cadherin binding|transmembrane receptor protein tyrosine phosphatase activity			lung(3)|ovary(2)|central_nervous_system(1)	6		Colorectal(10;0.234)				CTGGTGAATGCCTCTGGGAGA	0.453													114	242	---	---	---	---	capture	Missense_Mutation	SNP	7888125	7888125	PTPRM	18	C	A	A	A	1	0	0	0	0	1	0	0	0	338	26	4	4	12701	190
MUC16	94025	broad.mit.edu	37	19	9087832	9087832	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:9087832G>A	uc002mkp.2	-	1	4187	c.3983C>T	c.(3982-3984)ACG>ATG	p.T1328M		NM_024690	NP_078966	Q8WXI7	MUC16_HUMAN	mucin 16	1328	Thr-rich.|Extracellular (Potential).				cell adhesion	extracellular space|extrinsic to membrane|integral to membrane|plasma membrane	protein binding			lung(30)|ovary(15)|breast(8)|large_intestine(1)|skin(1)|prostate(1)|pancreas(1)	57						CTTAGGATCCGTAGTGGTGAT	0.527													30	72	---	---	---	---	capture	Missense_Mutation	SNP	9087832	9087832	MUC16	19	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	9883	190
RAB3D	9545	broad.mit.edu	37	19	11448018	11448018	+	Missense_Mutation	SNP	C	T	T	rs144965675	by1000genomes	TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:11448018C>T	uc002mqy.2	-	2	296	c.58G>A	c.(58-60)GAC>AAC	p.D20N		NM_004283	NP_004274	O95716	RAB3D_HUMAN	RAB3D, member RAS oncogene family	20					exocytosis|protein transport|small GTPase mediated signal transduction	plasma membrane	GTP binding|GTPase activity			ovary(2)	2						AACATATAGTCGAAGTTCTGA	0.557													94	217	---	---	---	---	capture	Missense_Mutation	SNP	11448018	11448018	RAB3D	19	C	T	T	T	1	0	0	0	0	1	0	0	0	403	31	1	1	12829	190
ZNF91	7644	broad.mit.edu	37	19	23543307	23543307	+	Missense_Mutation	SNP	G	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:23543307G>C	uc002nre.2	-	4	2587	c.2474C>G	c.(2473-2475)CCC>CGC	p.P825R	ZNF91_uc002nrd.2_5'Flank|ZNF91_uc010xrj.1_Missense_Mutation_p.P793R	NM_003430	NP_003421	Q05481	ZNF91_HUMAN	zinc finger protein 91	825						nucleus	DNA binding|sequence-specific DNA binding transcription factor activity|zinc ion binding				0		all_lung(12;0.0349)|Lung NSC(12;0.0538)|all_epithelial(12;0.0611)				ACATTTGTAGGGTTTCTCTCC	0.403													17	133	---	---	---	---	capture	Missense_Mutation	SNP	23543307	23543307	ZNF91	19	G	C	C	C	1	0	0	0	0	1	0	0	0	559	43	4	4	18076	190
C5AR1	728	broad.mit.edu	37	19	47823716	47823716	+	Missense_Mutation	SNP	C	T	T	rs146163744		TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:47823716C>T	uc002pgj.1	+	2	731	c.682C>T	c.(682-684)CGG>TGG	p.R228W		NM_001736	NP_001727	P21730	C5AR_HUMAN	complement component 5 receptor 1	228	Cytoplasmic (Potential).				activation of MAPK activity|activation of phospholipase C activity|cellular defense response|elevation of cytosolic calcium ion concentration|immune response|sensory perception of chemical stimulus	integral to plasma membrane	C5a anaphylatoxin receptor activity			ovary(2)|central_nervous_system(1)|skin(1)	4		all_cancers(25;2e-09)|all_epithelial(76;9.95e-08)|all_lung(116;7.27e-07)|Lung NSC(112;1.6e-06)|Ovarian(192;0.0139)|all_neural(266;0.026)|Breast(70;0.0503)		all cancers(93;0.000267)|OV - Ovarian serous cystadenocarcinoma(262;0.000618)|Epithelial(262;0.0142)|GBM - Glioblastoma multiforme(486;0.0242)		CATCCTGCTCCGGACGTGGAG	0.612													5	191	---	---	---	---	capture	Missense_Mutation	SNP	47823716	47823716	C5AR1	19	C	T	T	T	1	0	0	0	0	1	0	0	0	295	23	1	1	2259	190
KCNS3	3790	broad.mit.edu	37	2	18112318	18112318	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:18112318G>A	uc002rcv.2	+	3	494	c.43G>A	c.(43-45)GAA>AAA	p.E15K	KCNS3_uc002rcw.2_Missense_Mutation_p.E15K	NM_002252	NP_002243	Q9BQ31	KCNS3_HUMAN	potassium voltage-gated channel	15	Cytoplasmic (Potential).				energy reserve metabolic process|regulation of insulin secretion	Golgi apparatus|voltage-gated potassium channel complex	delayed rectifier potassium channel activity|potassium channel regulator activity			ovary(4)	4	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.158)					ACAAGACGAGGAACTTGTCAA	0.537													48	103	---	---	---	---	capture	Missense_Mutation	SNP	18112318	18112318	KCNS3	2	G	A	A	A	1	0	0	0	0	1	0	0	0	533	41	2	2	8012	190
APOB	338	broad.mit.edu	37	2	21227512	21227512	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:21227512C>T	uc002red.2	-	27	11952	c.11824G>A	c.(11824-11826)GCC>ACC	p.A3942T		NM_000384	NP_000375	P04114	APOB_HUMAN	apolipoprotein B precursor	3942					cholesterol homeostasis|cholesterol metabolic process|leukocyte migration|low-density lipoprotein particle clearance|low-density lipoprotein particle remodeling|platelet activation|positive regulation of cholesterol storage|positive regulation of macrophage derived foam cell differentiation|receptor-mediated endocytosis|response to virus	chylomicron remnant|clathrin-coated endocytic vesicle membrane|endoplasmic reticulum lumen|endoplasmic reticulum membrane|endosome lumen|endosome membrane|intermediate-density lipoprotein particle|low-density lipoprotein particle|mature chylomicron|microsome|plasma membrane|very-low-density lipoprotein particle	cholesterol transporter activity|enzyme binding|heparin binding|low-density lipoprotein particle receptor binding|phospholipid binding|protein heterodimerization activity			ovary(11)|skin(9)|central_nervous_system(3)|large_intestine(2)|upper_aerodigestive_tract(1)|pancreas(1)	27	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)				Atorvastatin(DB01076)	GTCTTAGAGGCTAACGTACCA	0.358													66	157	---	---	---	---	capture	Missense_Mutation	SNP	21227512	21227512	APOB	2	C	T	T	T	1	0	0	0	0	1	0	0	0	364	28	2	2	778	190
GPD2	2820	broad.mit.edu	37	2	157407115	157407115	+	Silent	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:157407115G>A	uc002tzf.3	+	8	1188	c.828G>A	c.(826-828)GGG>GGA	p.G276G	GPD2_uc010zch.1_Silent_p.G49G|GPD2_uc002tzd.3_Silent_p.G276G|GPD2_uc002tze.1_RNA	NM_001083112	NP_001076581	P43304	GPDM_HUMAN	glycerol-3-phosphate dehydrogenase 2,	276					cellular lipid metabolic process	glycerol-3-phosphate dehydrogenase complex|mitochondrial inner membrane	calcium ion binding|sn-glycerol-3-phosphate:ubiquinone-8 oxidoreductase activity			ovary(1)	1						CTTTCACAGGGCAGGAATTTG	0.438													4	149	---	---	---	---	capture	Silent	SNP	157407115	157407115	GPD2	2	G	A	A	A	1	0	0	0	0	0	0	0	1	535	42	2	2	6540	190
KIAA1486	57624	broad.mit.edu	37	2	226447519	226447519	+	Silent	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:226447519G>A	uc002voe.2	+	4	1561	c.1386G>A	c.(1384-1386)TCG>TCA	p.S462S	KIAA1486_uc010fxa.1_Intron|KIAA1486_uc002vof.1_Silent_p.S232S	NM_020864	NP_065915	Q9P242	K1486_HUMAN	hypothetical protein LOC57624	462	Pro-rich.									ovary(2)|central_nervous_system(1)	3		Renal(207;0.0112)|all_lung(227;0.0477)|Lung NSC(271;0.0644)|all_hematologic(139;0.101)|Esophageal squamous(248;0.129)		Epithelial(121;6.73e-10)|all cancers(144;4.32e-07)|Lung(261;0.0161)|LUSC - Lung squamous cell carcinoma(224;0.0223)		CTGTGCATTCGGGCAGCCTCT	0.622													7	65	---	---	---	---	capture	Silent	SNP	226447519	226447519	KIAA1486	2	G	A	A	A	1	0	0	0	0	0	0	0	1	496	39	1	1	8159	190
UGT1A7	54577	broad.mit.edu	37	2	234591304	234591304	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:234591304G>A	uc002vut.2	+	1	721	c.721G>A	c.(721-723)GCA>ACA	p.A241T	UGT1A8_uc010zmv.1_Intron|UGT1A8_uc002vup.2_Intron|UGT1A10_uc002vuq.3_Intron|UGT1A10_uc002vur.2_Intron|UGT1A9_uc010zmw.1_Intron|UGT1A9_uc002vus.2_Intron|UGT1A7_uc010zmx.1_Missense_Mutation_p.A241T	NM_019077	NP_061950	Q9HAW7	UD17_HUMAN	UDP glycosyltransferase 1 family, polypeptide A7	241					drug metabolic process|negative regulation of fatty acid metabolic process|xenobiotic metabolic process	endoplasmic reticulum membrane|integral to membrane|microsome	drug binding|enzyme inhibitor activity|glucuronosyltransferase activity|protein heterodimerization activity|protein homodimerization activity|protein kinase C binding|retinoic acid binding			ovary(1)	1		Breast(86;0.000765)|all_lung(227;0.00267)|Renal(207;0.00339)|all_hematologic(139;0.0116)|Acute lymphoblastic leukemia(138;0.0328)|Lung NSC(271;0.0457)|Lung SC(224;0.128)		Epithelial(121;8.93e-18)|BRCA - Breast invasive adenocarcinoma(100;0.000412)|Lung(119;0.00333)|LUSC - Lung squamous cell carcinoma(224;0.00746)		CCCTGTCACGGCATATGATCT	0.413													8	581	---	---	---	---	capture	Missense_Mutation	SNP	234591304	234591304	UGT1A7	2	G	A	A	A	1	0	0	0	0	1	0	0	0	546	42	2	2	16832	190
COL6A3	1293	broad.mit.edu	37	2	238275630	238275630	+	Nonsense_Mutation	SNP	C	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:238275630C>A	uc002vwl.2	-	11	5485	c.5200G>T	c.(5200-5202)GAG>TAG	p.E1734*	COL6A3_uc002vwo.2_Nonsense_Mutation_p.E1528*|COL6A3_uc010znj.1_Nonsense_Mutation_p.E1127*	NM_004369	NP_004360	P12111	CO6A3_HUMAN	alpha 3 type VI collagen isoform 1 precursor	1734	VWFA 9.|Nonhelical region.				axon guidance|cell adhesion|muscle organ development	collagen type VI|extracellular space	serine-type endopeptidase inhibitor activity			ovary(8)|central_nervous_system(6)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	18		Breast(86;0.000301)|Renal(207;0.000966)|all_hematologic(139;0.067)|Ovarian(221;0.0694)|all_lung(227;0.0943)|Melanoma(123;0.203)		Epithelial(121;1.23e-21)|OV - Ovarian serous cystadenocarcinoma(60;1.34e-10)|Kidney(56;5.71e-09)|KIRC - Kidney renal clear cell carcinoma(57;1.51e-07)|BRCA - Breast invasive adenocarcinoma(100;0.00025)|Lung(119;0.0142)|LUSC - Lung squamous cell carcinoma(224;0.034)		CTGCCTGCCTCAGGCACAAAG	0.572													3	52	---	---	---	---	capture	Nonsense_Mutation	SNP	238275630	238275630	COL6A3	2	C	A	A	A	1	0	0	0	0	0	1	0	0	377	29	5	4	3666	190
SSTR4	6754	broad.mit.edu	37	20	23016973	23016973	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr20:23016973G>A	uc002wsr.2	+	1	917	c.853G>A	c.(853-855)GTG>ATG	p.V285M		NM_001052	NP_001043	P31391	SSR4_HUMAN	somatostatin receptor 4	285	Extracellular (Potential).				G-protein signaling, coupled to cyclic nucleotide second messenger|negative regulation of cell proliferation	integral to plasma membrane	somatostatin receptor activity			ovary(1)	1	Colorectal(13;0.0518)|Lung NSC(19;0.0542)|all_lung(19;0.118)					GAACCTCTTCGTGACCAGCCT	0.552													63	86	---	---	---	---	capture	Missense_Mutation	SNP	23016973	23016973	SSTR4	20	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	15092	190
CLDN14	23562	broad.mit.edu	37	21	37833888	37833888	+	Missense_Mutation	SNP	C	T	T	rs142205038		TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr21:37833888C>T	uc002yvk.1	-	2	248	c.106G>A	c.(106-108)GTG>ATG	p.V36M	CLDN14_uc002yvn.1_Missense_Mutation_p.V36M|CLDN14_uc002yvo.1_Missense_Mutation_p.V36M|CLDN14_uc002yvl.1_Missense_Mutation_p.V36M|CLDN14_uc002yvm.1_Missense_Mutation_p.V36M	NM_012130	NP_036262	O95500	CLD14_HUMAN	claudin 14	36	Extracellular (Potential).				calcium-independent cell-cell adhesion|protein complex assembly|tight junction assembly	endoplasmic reticulum|integral to membrane|tight junction	identical protein binding|structural molecule activity				0						TTGGTGCCCACGTGCGCTGTC	0.622													13	9	---	---	---	---	capture	Missense_Mutation	SNP	37833888	37833888	CLDN14	21	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	3440	190
CDCP1	64866	broad.mit.edu	37	3	45132920	45132920	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:45132920C>T	uc003com.2	-	7	1873	c.1738G>A	c.(1738-1740)GTG>ATG	p.V580M		NM_022842	NP_073753	Q9H5V8	CDCP1_HUMAN	CUB domain-containing protein 1 isoform 1	580	Extracellular (Potential).					extracellular region|integral to membrane|plasma membrane				ovary(1)|central_nervous_system(1)|skin(1)	3				BRCA - Breast invasive adenocarcinoma(193;0.00928)|KIRC - Kidney renal clear cell carcinoma(197;0.0519)|Kidney(197;0.0651)		TCTCTGGGCACGCTGATGTTC	0.607													13	29	---	---	---	---	capture	Missense_Mutation	SNP	45132920	45132920	CDCP1	3	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	3064	190
GSK3B	2932	broad.mit.edu	37	3	119812236	119812236	+	Missense_Mutation	SNP	G	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:119812236G>C	uc003edo.2	-	1	1029	c.46C>G	c.(46-48)CCG>GCG	p.P16A	GSK3B_uc003edn.2_Missense_Mutation_p.P16A|uc003edp.2_5'Flank	NM_001146156	NP_001139628	P49841	GSK3B_HUMAN	glycogen synthase kinase 3 beta isoform 2	16					axon guidance|epithelial to mesenchymal transition|ER overload response|glycogen metabolic process|hippocampus development|negative regulation of apoptosis|negative regulation of protein binding|negative regulation of protein complex assembly|nerve growth factor receptor signaling pathway|peptidyl-serine phosphorylation|phosphatidylinositol-mediated signaling|positive regulation of cell-matrix adhesion|positive regulation of protein complex assembly|positive regulation of protein export from nucleus|positive regulation of Rac GTPase activity|regulation of microtubule-based process|superior temporal gyrus development	Axin-APC-beta-catenin-GSK3B complex|beta-catenin destruction complex|centrosome|cytosol|nucleus|plasma membrane	ATP binding|beta-catenin binding|NF-kappaB binding|p53 binding|protein kinase A catalytic subunit binding|protein serine/threonine kinase activity|RNA polymerase II transcription factor binding|tau-protein kinase activity|ubiquitin protein ligase binding			lung(2)	2				GBM - Glioblastoma multiforme(114;0.24)	Lithium(DB01356)	TGCTGCACCGGCTTGCAGCTC	0.483													4	202	---	---	---	---	capture	Missense_Mutation	SNP	119812236	119812236	GSK3B	3	G	C	C	C	1	0	0	0	0	1	0	0	0	546	42	4	4	6756	190
WFS1	7466	broad.mit.edu	37	4	6302612	6302612	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:6302612G>A	uc003giy.2	+	8	1256	c.1090G>A	c.(1090-1092)GTG>ATG	p.V364M	WFS1_uc003gix.2_Missense_Mutation_p.V364M|WFS1_uc003giz.2_Missense_Mutation_p.V182M	NM_001145853	NP_001139325	O76024	WFS1_HUMAN	wolframin	364					endoplasmic reticulum calcium ion homeostasis|endoplasmic reticulum unfolded protein response|ER overload response|ER-associated protein catabolic process|glucose homeostasis|kidney development|negative regulation of neuron apoptosis|negative regulation of sequence-specific DNA binding transcription factor activity|polyubiquitinated misfolded protein transport|positive regulation of calcium ion transport|positive regulation of growth|positive regulation of protein ubiquitination|positive regulation of proteolysis|protein stabilization|renal water homeostasis|sensory perception of sound|visual perception	dendrite|integral to endoplasmic reticulum membrane	activating transcription factor binding|ATPase binding|transporter activity|ubiquitin protein ligase binding			central_nervous_system(2)	2				Colorectal(103;0.0512)		CACCCTCAAGGTGTTCCAGGA	0.572													53	115	---	---	---	---	capture	Missense_Mutation	SNP	6302612	6302612	WFS1	4	G	A	A	A	1	0	0	0	0	1	0	0	0	572	44	2	2	17241	190
TLR6	10333	broad.mit.edu	37	4	38830723	38830723	+	Silent	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:38830723C>T	uc003gtm.2	-	1	438	c.372G>A	c.(370-372)AGG>AGA	p.R124R	TLR6_uc010ifg.1_Silent_p.R124R	NM_006068	NP_006059	Q9Y2C9	TLR6_HUMAN	toll-like receptor 6 precursor	124	LRR 4.|Extracellular (Potential).				activation of NF-kappaB-inducing kinase activity|cellular response to diacyl bacterial lipopeptide|defense response to bacterium|detection of diacyl bacterial lipopeptide|inflammatory response|innate immune response|MyD88-dependent toll-like receptor signaling pathway|positive regulation of I-kappaB kinase/NF-kappaB cascade|positive regulation of interleukin-6 biosynthetic process|positive regulation of JUN kinase activity|Toll signaling pathway|toll-like receptor 1 signaling pathway|toll-like receptor 2 signaling pathway|toll-like receptor 4 signaling pathway	integral to plasma membrane|phagocytic vesicle membrane	lipopeptide binding|transmembrane receptor activity			ovary(2)	2						GATCTAAATGCCTGAAACTCA	0.363													40	93	---	---	---	---	capture	Silent	SNP	38830723	38830723	TLR6	4	C	T	T	T	1	0	0	0	0	0	0	0	1	337	26	2	2	15840	190
PDGFRA	5156	broad.mit.edu	37	4	55155241	55155241	+	Missense_Mutation	SNP	G	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:55155241G>C	uc003han.3	+	21	3171	c.2840G>C	c.(2839-2841)AGT>ACT	p.S947T	PDGFRA_uc003haa.2_Missense_Mutation_p.S707T	NM_006206	NP_006197	P16234	PGFRA_HUMAN	platelet-derived growth factor receptor alpha	947	Protein kinase.|Cytoplasmic (Potential).				cardiac myofibril assembly|cell activation|luteinization|metanephric glomerular capillary formation|peptidyl-tyrosine phosphorylation|positive regulation of cell migration|positive regulation of DNA replication|positive regulation of fibroblast proliferation|protein autophosphorylation|retina vasculature development in camera-type eye	cytoplasm|integral to plasma membrane|nucleus	ATP binding|platelet-derived growth factor alpha-receptor activity|platelet-derived growth factor binding|platelet-derived growth factor receptor binding|protein homodimerization activity|vascular endothelial growth factor receptor activity			soft_tissue(572)|small_intestine(40)|stomach(16)|lung(16)|central_nervous_system(13)|haematopoietic_and_lymphoid_tissue(7)|skin(3)|ovary(3)|gastrointestinal_tract_(site_indeterminate)(1)|autonomic_ganglia(1)|prostate(1)|bone(1)	674	all_cancers(7;0.000425)|all_lung(4;0.000343)|Lung NSC(11;0.000467)|all_epithelial(27;0.0131)|all_neural(26;0.0209)|Glioma(25;0.08)		GBM - Glioblastoma multiforme(1;4.18e-71)|all cancers(1;4.76e-45)|LUSC - Lung squamous cell carcinoma(32;0.00256)		Becaplermin(DB00102)|Imatinib(DB00619)|Sunitinib(DB01268)	TACCACCTGAGTGAGATTGTG	0.498			Mis|O|T	FIP1L1	GIST|idiopathic hypereosinophilic syndrome				Gastrointestinal_Stromal_Tumors_Sporadic_Multiple_Primary|Familial_Intestinal_Neurofibromatosis	TSP Lung(21;0.16)			16	45	---	---	---	---	capture	Missense_Mutation	SNP	55155241	55155241	PDGFRA	4	G	C	C	C	1	0	0	0	0	1	0	0	0	468	36	4	4	11564	190
PDCL2	132954	broad.mit.edu	37	4	56435994	56435994	+	Missense_Mutation	SNP	T	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:56435994T>C	uc003hbb.2	-	4	356	c.253A>G	c.(253-255)AAA>GAA	p.K85E		NM_152401	NP_689614	Q8N4E4	PDCL2_HUMAN	phosducin-like 2	85											0	Lung NSC(11;0.00256)|Glioma(25;0.08)|all_epithelial(27;0.0863)|all_neural(26;0.101)		LUSC - Lung squamous cell carcinoma(4;1.69e-07)|Lung(4;1.03e-06)|Epithelial(7;0.00669)			TTTTGTTTTTTCTTAAGAGCT	0.289													3	6	---	---	---	---	capture	Missense_Mutation	SNP	56435994	56435994	PDCL2	4	T	C	C	C	1	0	0	0	0	1	0	0	0	806	62	3	3	11530	190
PPBP	5473	broad.mit.edu	37	4	74853312	74853312	+	Missense_Mutation	SNP	G	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:74853312G>T	uc003hhj.2	-	2	286	c.206C>A	c.(205-207)ACC>AAC	p.T69N		NM_002704	NP_002695	P02775	CXCL7_HUMAN	pro-platelet basic protein precursor	69					chemotaxis|defense response to bacterium|immune response|platelet activation|platelet degranulation|positive regulation of cell division	extracellular space|platelet alpha granule lumen	chemokine activity|glucose transmembrane transporter activity|growth factor activity			ovary(2)|central_nervous_system(1)|skin(1)	4	Breast(15;0.00136)		all cancers(17;0.00273)|Lung(101;0.196)			AATTCCAGAGGTTGTCTTTAT	0.363													41	103	---	---	---	---	capture	Missense_Mutation	SNP	74853312	74853312	PPBP	4	G	T	T	T	1	0	0	0	0	1	0	0	0	572	44	4	4	12204	190
TTC29	83894	broad.mit.edu	37	4	147824706	147824706	+	Silent	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:147824706G>A	uc003ikw.3	-	6	803	c.576C>T	c.(574-576)TAC>TAT	p.Y192Y	TTC29_uc010ipc.2_RNA|TTC29_uc003ikx.3_Silent_p.Y218Y|TTC29_uc010ipd.1_Silent_p.Y192Y	NM_031956	NP_114162	Q8NA56	TTC29_HUMAN	tetratricopeptide repeat domain 29	192	TPR 1.						binding				0	all_hematologic(180;0.151)					CATCTTCCTCGTAGAGAAGAC	0.458													15	38	---	---	---	---	capture	Silent	SNP	147824706	147824706	TTC29	4	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	16578	190
CDC20B	166979	broad.mit.edu	37	5	54423154	54423154	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:54423154C>T	uc003jpo.1	-	8	1095	c.920G>A	c.(919-921)CGG>CAG	p.R307Q	CDC20B_uc003jpn.1_Missense_Mutation_p.R307Q|CDC20B_uc010ivu.1_Missense_Mutation_p.R307Q|CDC20B_uc010ivv.1_Missense_Mutation_p.R307Q	NM_152623	NP_689836	Q86Y33	CD20B_HUMAN	CDC20 cell division cycle 20 homolog B isoform	307	WD 2.										0		Lung NSC(810;0.000744)|Breast(144;0.159)|Prostate(74;0.194)	LUSC - Lung squamous cell carcinoma(15;0.225)			ATTTCTCAGCCGCTTTTTAGT	0.438													61	113	---	---	---	---	capture	Missense_Mutation	SNP	54423154	54423154	CDC20B	5	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	3031	190
FAT2	2196	broad.mit.edu	37	5	150947475	150947475	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:150947475C>T	uc003lue.3	-	1	1031	c.1018G>A	c.(1018-1020)GGC>AGC	p.G340S	GM2A_uc011dcs.1_Intron|FAT2_uc010jhx.1_Missense_Mutation_p.G340S	NM_001447	NP_001438	Q9NYQ8	FAT2_HUMAN	FAT tumor suppressor 2 precursor	340	Extracellular (Potential).				epithelial cell migration|homophilic cell adhesion	cell-cell adherens junction|integral to membrane|nucleus	calcium ion binding			ovary(4)|upper_aerodigestive_tract(1)|skin(1)	6		Medulloblastoma(196;0.0912)|all_hematologic(541;0.104)	KIRC - Kidney renal clear cell carcinoma(527;0.000785)|Kidney(363;0.00101)			AAATAAGGGCCGCTCCCACTC	0.502													63	142	---	---	---	---	capture	Missense_Mutation	SNP	150947475	150947475	FAT2	5	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	5636	190
LARP1	23367	broad.mit.edu	37	5	154193504	154193504	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:154193504G>A	uc003lvp.2	+	19	3568	c.3139G>A	c.(3139-3141)GGC>AGC	p.G1047S	LARP1_uc003lvo.2_Missense_Mutation_p.G970S	NM_033551	NP_291029	Q6PKG0	LARP1_HUMAN	la related protein isoform 2	1047	Poly-Gly.						protein binding|RNA binding			ovary(2)|pancreas(1)|skin(1)	4	Renal(175;0.00488)	Medulloblastoma(196;0.0354)|all_neural(177;0.147)	KIRC - Kidney renal clear cell carcinoma(527;0.00112)			AGGAGGTGGCGGCGGTGAGGG	0.637													4	108	---	---	---	---	capture	Missense_Mutation	SNP	154193504	154193504	LARP1	5	G	A	A	A	1	0	0	0	0	1	0	0	0	507	39	1	1	8548	190
EYA4	2070	broad.mit.edu	37	6	133844286	133844286	+	Missense_Mutation	SNP	T	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr6:133844286T>C	uc003qec.3	+	18	2167	c.1709T>C	c.(1708-1710)ATT>ACT	p.I570T	EYA4_uc011ecq.1_Missense_Mutation_p.I516T|EYA4_uc011ecr.1_Missense_Mutation_p.I522T|EYA4_uc003qed.3_Missense_Mutation_p.I570T|EYA4_uc003qee.3_Missense_Mutation_p.I547T|EYA4_uc011ecs.1_Missense_Mutation_p.I576T|uc003qeg.1_Intron	NM_004100	NP_004091	O95677	EYA4_HUMAN	eyes absent 4 isoform a	570					anatomical structure morphogenesis|chromatin modification|DNA repair|multicellular organismal development|regulation of transcription, DNA-dependent|transcription, DNA-dependent|visual perception	cytoplasm|nucleus	metal ion binding|protein tyrosine phosphatase activity			large_intestine(2)	2	Colorectal(23;0.221)			GBM - Glioblastoma multiforme(68;0.00457)|OV - Ovarian serous cystadenocarcinoma(155;0.0152)		GCTTTCCCCATTGAGAATATT	0.383													5	215	---	---	---	---	capture	Missense_Mutation	SNP	133844286	133844286	EYA4	6	T	C	C	C	1	0	0	0	0	1	0	0	0	676	52	3	3	5286	190
SDK1	221935	broad.mit.edu	37	7	4050700	4050700	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:4050700C>T	uc003smx.2	+	15	2373	c.2234C>T	c.(2233-2235)GCG>GTG	p.A745V	SDK1_uc010kso.2_Missense_Mutation_p.A21V	NM_152744	NP_689957	Q7Z5N4	SDK1_HUMAN	sidekick 1 precursor	745	Fibronectin type-III 1.				cell adhesion	integral to membrane				large_intestine(3)|ovary(2)|skin(1)	6		all_cancers(1;0.127)|Ovarian(82;0.0177)|Myeloproliferative disorder(862;0.194)		UCEC - Uterine corpus endometrioid carcinoma (126;0.121)|OV - Ovarian serous cystadenocarcinoma(56;9.65e-15)		CGGGTGTGCGCGGTGAATGAA	0.622													15	36	---	---	---	---	capture	Missense_Mutation	SNP	4050700	4050700	SDK1	7	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	13861	190
TMEM196	256130	broad.mit.edu	37	7	19765216	19765216	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:19765216C>T	uc011jyg.1	-	3	465	c.380G>A	c.(379-381)CGA>CAA	p.R127Q	TMEM196_uc003sur.2_RNA	NM_152774	NP_689987	Q5HYL7	TM196_HUMAN	transmembrane protein 196	133						integral to membrane					0						ACTGGCTAGTCGACAAGTGAG	0.498													31	112	---	---	---	---	capture	Missense_Mutation	SNP	19765216	19765216	TMEM196	7	C	T	T	T	1	0	0	0	0	1	0	0	0	403	31	1	1	16001	190
EGFR	1956	broad.mit.edu	37	7	55211080	55211080	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:55211080G>A	uc003tqk.2	+	3	569	c.323G>A	c.(322-324)AGA>AAA	p.R108K	EGFR_uc003tqh.2_Missense_Mutation_p.R108K|EGFR_uc003tqi.2_Missense_Mutation_p.R108K|EGFR_uc003tqj.2_Missense_Mutation_p.R108K|EGFR_uc010kzg.1_Missense_Mutation_p.R108K|EGFR_uc011kco.1_Missense_Mutation_p.R55K	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a	108	Approximate.|Extracellular (Potential).				activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity	p.R108K(7)|p.V30_R297>G(5)		lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)	CAGATCATCAGAGGAAATATG	0.423		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			393	575	---	---	---	---	capture	Missense_Mutation	SNP	55211080	55211080	EGFR	7	G	A	A	A	1	0	0	0	0	1	0	0	0	429	33	2	2	4922	190
EGFR	1956	broad.mit.edu	37	7	55221822	55221822	+	Missense_Mutation	SNP	C	T	T	rs149840192		TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:55221822C>T	uc003tqk.2	+	7	1112	c.866C>T	c.(865-867)GCC>GTC	p.A289V	EGFR_uc003tqh.2_Missense_Mutation_p.A289V|EGFR_uc003tqi.2_Missense_Mutation_p.A289V|EGFR_uc003tqj.2_Missense_Mutation_p.A289V|EGFR_uc010kzg.1_Missense_Mutation_p.A244V|EGFR_uc011kco.1_Missense_Mutation_p.A236V|EGFR_uc011kcp.1_5'Flank|EGFR_uc011kcq.1_5'Flank	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a	289	Approximate.|Extracellular (Potential).				activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity	p.A289V(20)|p.V30_R297>G(5)|p.A289D(3)|p.A289T(3)		lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)	AGCTTTGGTGCCACCTGCGTG	0.592		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			16	928	---	---	---	---	capture	Missense_Mutation	SNP	55221822	55221822	EGFR	7	C	T	T	T	1	0	0	0	0	1	0	0	0	338	26	2	2	4922	190
EGFR	1956	broad.mit.edu	37	7	55241677	55241677	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:55241677G>A	uc003tqk.2	+	18	2371	c.2125G>A	c.(2125-2127)GAA>AAA	p.E709K	EGFR_uc010kzg.1_Missense_Mutation_p.E664K|EGFR_uc011kco.1_Missense_Mutation_p.E656K	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a	709	Cytoplasmic (Potential).		E -> K (found in a lung cancer sample).|E -> A (found in a lung cancer sample).		activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity	p.E709K(17)|p.E709A(11)|p.E709G(7)|p.E709V(5)|p.E709_T710>D(5)|p.E709H(2)|p.E709_T710>G(1)|p.E709_T710>A(1)|p.E709fs*1(1)		lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)	GATCTTGAAGGAAACTGAATT	0.567		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			17	894	---	---	---	---	capture	Missense_Mutation	SNP	55241677	55241677	EGFR	7	G	A	A	A	1	0	0	0	0	1	0	0	0	533	41	2	2	4922	190
EGFR	1956	broad.mit.edu	37	7	55241694	55241694	+	Missense_Mutation	SNP	G	C	C			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:55241694G>C	uc003tqk.2	+	18	2388	c.2142G>C	c.(2140-2142)AAG>AAC	p.K714N	EGFR_uc010kzg.1_Missense_Mutation_p.K669N|EGFR_uc011kco.1_Missense_Mutation_p.K661N	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a	714	Cytoplasmic (Potential).|Protein kinase.				activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity			lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)	AATTCAAAAAGATCAAAGTGC	0.567		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			15	907	---	---	---	---	capture	Missense_Mutation	SNP	55241694	55241694	EGFR	7	G	C	C	C	1	0	0	0	0	1	0	0	0	425	33	4	4	4922	190
ZNF3	7551	broad.mit.edu	37	7	99669056	99669056	+	Nonsense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:99669056G>A	uc003usq.2	-	6	1358	c.1051C>T	c.(1051-1053)CAG>TAG	p.Q351*	ZNF3_uc003usp.2_Intron|ZNF3_uc003usr.2_Nonsense_Mutation_p.Q351*|ZNF3_uc010lgj.2_Nonsense_Mutation_p.Q315*|ZNF3_uc003uss.2_Nonsense_Mutation_p.Q358*|ZNF3_uc003ust.3_Nonsense_Mutation_p.Q351*	NM_032924	NP_116313	P17036	ZNF3_HUMAN	zinc finger protein 3 isoform 2	351	C2H2-type 6.			GEKPYECNECGKAFSQSSHLYQHQRIHTGEKPYECMECGGK FTYSSGLIQHQ -> EALPTFVTLIRLLPSVDPIVTNEAAF PAESLATIFALIWRLFCVHSLMFKKV (in Ref. 2; BAA91019).	cell differentiation|leukocyte activation|multicellular organismal development	nucleus	DNA binding|identical protein binding|sequence-specific DNA binding transcription factor activity|zinc ion binding			ovary(1)	1	Lung NSC(181;0.0181)|all_lung(186;0.0284)|Esophageal squamous(72;0.0439)	Ovarian(593;2.06e-05)|Myeloproliferative disorder(862;0.0122)|Breast(660;0.029)	STAD - Stomach adenocarcinoma(171;0.129)			TGTGAGCTCTGGCTGAAGGCT	0.473													52	173	---	---	---	---	capture	Nonsense_Mutation	SNP	99669056	99669056	ZNF3	7	G	A	A	A	1	0	0	0	0	0	1	0	0	611	47	5	2	17709	190
SERPINE1	5054	broad.mit.edu	37	7	100779013	100779013	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:100779013G>A	uc003uxt.2	+	7	1166	c.1018G>A	c.(1018-1020)GTC>ATC	p.V340I	SERPINE1_uc011kkj.1_Missense_Mutation_p.V325I|SERPINE1_uc003uxu.1_3'UTR	NM_000602	NP_000593	P05121	PAI1_HUMAN	plasminogen activator inhibitor-1 isoform 1	340					angiogenesis|cellular response to chemical stimulus|cellular response to lipopolysaccharide|chronological cell aging|defense response to Gram-negative bacterium|fibrinolysis|negative regulation of apoptosis|negative regulation of cell adhesion mediated by integrin|negative regulation of fibrinolysis|negative regulation of plasminogen activation|negative regulation of smooth muscle cell migration|negative regulation of smooth muscle cell-matrix adhesion|negative regulation of vascular wound healing|platelet activation|platelet degranulation|positive regulation of angiogenesis|positive regulation of interleukin-8 production|positive regulation of leukotriene production involved in inflammatory response|positive regulation of monocyte chemotaxis|positive regulation of receptor-mediated endocytosis|regulation of receptor activity	extracellular matrix|extracellular space|plasma membrane|platelet alpha granule lumen	protease binding|serine-type endopeptidase inhibitor activity			ovary(1)|lung(1)|central_nervous_system(1)	3	Lung NSC(181;0.136)|all_lung(186;0.182)				Atorvastatin(DB01076)|Dimethyl sulfoxide(DB01093)|Drotrecogin alfa(DB00055)|Simvastatin(DB00641)|Tenecteplase(DB00031)|Troglitazone(DB00197)|Urokinase(DB00013)	GCCTCTCCACGTCGCGCAGGC	0.582													18	131	---	---	---	---	capture	Missense_Mutation	SNP	100779013	100779013	SERPINE1	7	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	14004	190
RELN	5649	broad.mit.edu	37	7	103205920	103205920	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:103205920C>T	uc003vca.2	-	34	5175	c.5015G>A	c.(5014-5016)TGT>TAT	p.C1672Y	RELN_uc010liz.2_Missense_Mutation_p.C1672Y	NM_005045	NP_005036	P78509	RELN_HUMAN	reelin isoform a	1672					axon guidance|cell adhesion|cerebral cortex tangential migration|glial cell differentiation|neuron migration|peptidyl-tyrosine phosphorylation|positive regulation of protein kinase activity|positive regulation of small GTPase mediated signal transduction|response to pain|spinal cord patterning	cytoplasm|dendrite|extracellular space|proteinaceous extracellular matrix	metal ion binding|protein serine/threonine/tyrosine kinase activity|serine-type peptidase activity			ovary(8)|upper_aerodigestive_tract(5)|large_intestine(2)|central_nervous_system(2)|skin(1)|pancreas(1)	19				COAD - Colon adenocarcinoma(1;8.98e-05)|Colorectal(1;0.00184)		GGGCTTGCTACAGCCCATGCT	0.448													20	77	---	---	---	---	capture	Missense_Mutation	SNP	103205920	103205920	RELN	7	C	T	T	T	1	0	0	0	0	1	0	0	0	221	17	2	2	13115	190
NRCAM	4897	broad.mit.edu	37	7	107824688	107824688	+	Missense_Mutation	SNP	C	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:107824688C>A	uc003vfb.2	-	22	2772	c.2301G>T	c.(2299-2301)TGG>TGT	p.W767C	NRCAM_uc003vfc.2_Missense_Mutation_p.W751C|NRCAM_uc011kmk.1_Missense_Mutation_p.W762C|NRCAM_uc003vfd.2_Missense_Mutation_p.W743C|NRCAM_uc003vfe.2_Missense_Mutation_p.W743C	NM_001037132	NP_001032209	Q92823	NRCAM_HUMAN	neuronal cell adhesion molecule isoform A	767	Fibronectin type-III 2.|Extracellular (Potential).				angiogenesis|axon guidance|axonal fasciculation|cell-cell adhesion|central nervous system development|clustering of voltage-gated sodium channels|neuron migration|positive regulation of neuron differentiation|regulation of axon extension|synapse assembly	external side of plasma membrane|integral to plasma membrane	ankyrin binding			ovary(3)|breast(2)	5						AGCTCACCTTCCACGTAATCA	0.368													49	201	---	---	---	---	capture	Missense_Mutation	SNP	107824688	107824688	NRCAM	7	C	A	A	A	1	0	0	0	0	1	0	0	0	390	30	4	4	10551	190
FAM71F1	84691	broad.mit.edu	37	7	128355633	128355633	+	Silent	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:128355633G>A	uc003vno.1	+	1	191	c.138G>A	c.(136-138)CCG>CCA	p.P46P	FAM71F1_uc010llo.1_Intron|FAM71F1_uc011koq.1_Intron|FAM71F1_uc003vnm.1_Intron|FAM71F1_uc003vnn.1_Intron|FAM71F1_uc010llp.1_RNA|FAM71F1_uc003vnp.1_Silent_p.P46P	NM_032599	NP_115988	Q96KD3	F71F1_HUMAN	testes development-related NYD-SP18	46										skin(1)	1						ATGGAGAGCCGAACCCTGGAG	0.522													37	196	---	---	---	---	capture	Silent	SNP	128355633	128355633	FAM71F1	7	G	A	A	A	1	0	0	0	0	0	0	0	1	470	37	1	1	5560	190
UBE3C	9690	broad.mit.edu	37	7	157041143	157041143	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:157041143G>A	uc010lqs.2	+	19	2875	c.2563G>A	c.(2563-2565)GAC>AAC	p.D855N	UBE3C_uc003wni.3_Missense_Mutation_p.D218N	NM_014671	NP_055486	Q15386	UBE3C_HUMAN	ubiquitin protein ligase E3C	855	HECT.				protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process	nucleus|proteasome complex	protein binding|ubiquitin-protein ligase activity			ovary(2)|lung(2)|large_intestine(1)	5		all_hematologic(28;0.0185)|all_epithelial(9;0.0664)	OV - Ovarian serous cystadenocarcinoma(82;0.00448)	UCEC - Uterine corpus endometrioid carcinoma (81;0.19)		TGCCGACGTGGACATTCACCA	0.502													99	309	---	---	---	---	capture	Missense_Mutation	SNP	157041143	157041143	UBE3C	7	G	A	A	A	1	0	0	0	0	1	0	0	0	533	41	2	2	16763	190
UBR5	51366	broad.mit.edu	37	8	103289358	103289358	+	Silent	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:103289358C>T	uc003ykr.1	-	45	6384	c.6351G>A	c.(6349-6351)CGG>CGA	p.R2117R	UBR5_uc003yks.1_Silent_p.R2117R	NM_015902	NP_056986	O95071	UBR5_HUMAN	ubiquitin protein ligase E3 component n-recognin	2117					cell proliferation|positive regulation of canonical Wnt receptor signaling pathway|positive regulation of catenin import into nucleus|positive regulation of protein import into nucleus, translocation|progesterone receptor signaling pathway|protein polyubiquitination|protein ubiquitination involved in ubiquitin-dependent protein catabolic process|response to DNA damage stimulus	nucleus|soluble fraction	protein binding|RNA binding|ubiquitin-ubiquitin ligase activity|zinc ion binding			lung(16)|ovary(4)|large_intestine(3)|breast(2)|upper_aerodigestive_tract(1)|central_nervous_system(1)|kidney(1)	28	all_cancers(14;8e-07)|all_epithelial(15;2.18e-08)|Lung NSC(17;2.55e-05)|all_lung(17;8.85e-05)		OV - Ovarian serous cystadenocarcinoma(57;0.000442)			CTTTTTTTTGCCGGTTTTGCA	0.378													4	202	---	---	---	---	capture	Silent	SNP	103289358	103289358	UBR5	8	C	T	T	T	1	0	0	0	0	0	0	0	1	327	26	2	2	16787	190
COL14A1	7373	broad.mit.edu	37	8	121267573	121267573	+	Missense_Mutation	SNP	G	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:121267573G>T	uc003yox.2	+	23	3112	c.2847G>T	c.(2845-2847)AGG>AGT	p.R949S	COL14A1_uc003yoy.2_Missense_Mutation_p.R627S	NM_021110	NP_066933	Q05707	COEA1_HUMAN	collagen, type XIV, alpha 1 precursor	949	Fibronectin type-III 8.				cell-cell adhesion|collagen fibril organization	collagen type XIV|extracellular space	collagen binding|extracellular matrix structural constituent|protein binding, bridging			ovary(4)|kidney(4)|skin(2)|pancreas(1)|central_nervous_system(1)	12	Lung NSC(37;6.52e-07)|Ovarian(258;0.00769)|Hepatocellular(40;0.161)		OV - Ovarian serous cystadenocarcinoma(1;6.47e-38)|STAD - Stomach adenocarcinoma(47;0.00503)			CAGCCTATAGGGTTGTTATAG	0.453													69	120	---	---	---	---	capture	Missense_Mutation	SNP	121267573	121267573	COL14A1	8	G	T	T	T	1	0	0	0	0	1	0	0	0	555	43	4	4	3636	190
IFNE	338376	broad.mit.edu	37	9	21481272	21481272	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:21481272C>T	uc003zpg.2	-	1	1041	c.422G>A	c.(421-423)AGA>AAA	p.R141K	LOC554202_uc003zpe.2_Intron|LOC554202_uc003zpf.2_Intron	NM_176891	NP_795372	Q86WN2	IFNE_HUMAN	interferon, epsilon precursor	141					defense response|response to virus	extracellular space	cytokine activity|cytokine receptor binding				0						AACTTGTAATCTAAGGTTATC	0.433													137	124	---	---	---	---	capture	Missense_Mutation	SNP	21481272	21481272	IFNE	9	C	T	T	T	1	0	0	0	0	1	0	0	0	416	32	2	2	7472	190
IL3RA	3563	broad.mit.edu	37	X	1484071	1484071	+	Missense_Mutation	SNP	C	T	T			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:1484071C>T	uc004cps.2	+	9	1149	c.800C>T	c.(799-801)ACG>ATG	p.T267M	IL3RA_uc011mhd.1_Missense_Mutation_p.T189M	NM_002183	NP_002174	P26951	IL3RA_HUMAN	interleukin 3 receptor, alpha precursor	267	Extracellular (Potential).					integral to membrane|plasma membrane	interleukin-3 receptor activity			skin(2)|lung(1)	3		all_cancers(21;4.28e-07)|all_epithelial(21;2.07e-08)|all_lung(23;2.81e-05)|Lung NSC(23;0.000693)|Lung SC(21;0.122)			Sargramostim(DB00020)	AATCCTGGAACGTACACAGTA	0.433													25	52	---	---	---	---	capture	Missense_Mutation	SNP	1484071	1484071	IL3RA	23	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	7618	190
STS	412	broad.mit.edu	37	X	7177573	7177573	+	Missense_Mutation	SNP	G	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:7177573G>A	uc004cry.3	+	5	826	c.581G>A	c.(580-582)GGG>GAG	p.G194E		NM_000351	NP_000342	P08842	STS_HUMAN	steryl-sulfatase precursor	194	Helical.				female pregnancy|steroid catabolic process	endoplasmic reticulum membrane|endosome|Golgi apparatus|integral to membrane|lysosome|microsome|plasma membrane	metal ion binding|steryl-sulfatase activity			central_nervous_system(1)	1		Colorectal(8;0.0136)|Medulloblastoma(8;0.184)			Estrone(DB00655)	CAGATCGTCGGGGTCACCCTC	0.567									Ichthyosis				3	56	---	---	---	---	capture	Missense_Mutation	SNP	7177573	7177573	STS	23	G	A	A	A	1	0	0	0	0	1	0	0	0	559	43	2	2	15222	190
OR10H2	26538	broad.mit.edu	37	19	15839588	15839589	+	Frame_Shift_Ins	INS	-	CTTATTGTGG	CTTATTGTGG			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:15839588_15839589insCTTATTGTGG	uc002nbm.2	+	1	755_756	c.735_736insCTTATTGTGG	c.(733-738)CACCTTfs	p.H245fs		NM_013939	NP_039227	O60403	O10H2_HUMAN	olfactory receptor, family 10, subfamily H,	245_246	Helical; Name=6; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|central_nervous_system(1)|skin(1)	3	all_hematologic(1;0.0517)|Acute lymphoblastic leukemia(2;0.074)					GTGCCTCTCACCTTATTGTGGT	0.540													39	172	---	---	---	---	capture_indel	Frame_Shift_Ins	INS	15839588	15839589	OR10H2	19	-	CTTATTGTGG	CTTATTGTGG	CTTATTGTGG	1	0	1	1	0	0	0	0	0	233	18	5	5	10810	190
WWC2	80014	broad.mit.edu	37	4	184166575	184166576	+	Frame_Shift_Ins	INS	-	A	A			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:184166575_184166576insA	uc010irx.2	+	6	791_792	c.609_610insA	c.(607-612)GATAAAfs	p.D203fs	WWC2_uc003ivk.3_5'UTR|WWC2_uc003ivl.3_RNA|WWC2_uc010iry.2_Intron	NM_024949	NP_079225	Q6AWC2	WWC2_HUMAN	WW and C2 domain containing 2	203_204										ovary(2)|lung(1)	3		all_lung(41;5.28e-14)|Lung NSC(41;1.35e-13)|Colorectal(36;0.00681)|Hepatocellular(41;0.00886)|Renal(120;0.00992)|Prostate(90;0.0237)|all_hematologic(60;0.0592)|Esophageal squamous(56;0.179)|all_neural(102;0.202)		all cancers(43;3.38e-24)|Epithelial(43;1.4e-20)|OV - Ovarian serous cystadenocarcinoma(60;1.09e-09)|GBM - Glioblastoma multiforme(59;3.33e-05)|Colorectal(24;3.58e-05)|STAD - Stomach adenocarcinoma(60;4.21e-05)|COAD - Colon adenocarcinoma(29;0.000171)|LUSC - Lung squamous cell carcinoma(40;0.0145)|READ - Rectum adenocarcinoma(43;0.242)		ACAGAATTGATAAAAAAATGTC	0.356													10	20	---	---	---	---	capture_indel	Frame_Shift_Ins	INS	184166575	184166576	WWC2	4	-	A	A	A	1	0	1	1	0	0	0	0	0	634	49	5	5	17293	190
SATL1	340562	broad.mit.edu	37	X	84349151	84349151	+	Frame_Shift_Del	DEL	A	-	-			TCGA-27-1831-01	TCGA-27-1831-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:84349151delA	uc011mqx.1	-	4	1859	c.1859delT	c.(1858-1860)GTCfs	p.V620fs	SATL1_uc004een.2_Frame_Shift_Del_p.V620fs	NM_001163541	NP_001157013	Q86VE3	SATL1_HUMAN	spermidine/spermine N1-acetyl transferase-like 1	433	N-acetyltransferase.|Acetyl-CoA binding (By similarity).						N-acetyltransferase activity			breast(2)	2						AGCTTGTGTGACATAAAAGTC	0.338													70	43	---	---	---	---	capture_indel	Frame_Shift_Del	DEL	84349151	84349151	SATL1	23	A	-	-	-	1	0	1	0	1	0	0	0	0	130	10	5	5	13747	190
