Hugo_Symbol	Entrez_Gene_Id	Center	NCBI_Build	Chromosome	Start_position	End_position	Strand	Variant_Classification	Variant_Type	Reference_Allele	Tumor_Seq_Allele1	Tumor_Seq_Allele2	dbSNP_RS	dbSNP_Val_Status	Tumor_Sample_Barcode	Matched_Norm_Sample_Barcode	Match_Norm_Seq_Allele1	Match_Norm_Seq_Allele2	Tumor_Validation_Allele1	Tumor_Validation_Allele2	Match_Norm_Validation_Allele1	Match_Norm_Validation_Allele2	Verification_Status	Validation_Status	Mutation_Status	Sequencing_Phase	Sequence_Source	Validation_Method	Score	BAM_file	Sequencer	Genome_Change	Annotation_Transcript	Transcript_Strand	Transcript_Exon	Transcript_Position	cDNA_Change	Codon_Change	Protein_Change	Other_Transcripts	Refseq_mRNA_Id	Refseq_prot_Id	SwissProt_acc_Id	SwissProt_entry_Id	Description	UniProt_AApos	UniProt_Region	UniProt_Site	UniProt_Natural_Variations	UniProt_Experimental_Info	GO_Biological_Process	GO_Cellular_Component	GO_Molecular_Function	COSMIC_overlapping_mutations	COSMIC_fusion_genes	COSMIC_tissue_types_affected	COSMIC_total_alterations_in_gene	Tumorscape_Amplification_Peaks	Tumorscape_Deletion_Peaks	TCGAscape_Amplification_Peaks	TCGAscape_Deletion_Peaks	DrugBank	ref_context	gc_content	CCLE_ONCOMAP_overlapping_mutations	CCLE_ONCOMAP_total_mutations_in_gene	CGC_Mutation_Type	CGC_Translocation_Partner	CGC_Tumor_Types_Somatic	CGC_Tumor_Types_Germline	CGC_Other_Diseases	DNARepairGenes_Role	FamilialCancerDatabase_Syndromes	MUTSIG_Published_Results	OREGANNO_ID	OREGANNO_Values	t_alt_count	t_ref_count	validation_status	validation_method	validation_tumor_sample	validation_alt_allele	dataset	type	classification	start	end	gene	chr	ref_allele	tum_allele1	tum_allele2	newbase	is_coding	is_flank	is_indel	is_ins	is_del	is_missense	is_nonsense	is_splice	is_silent	context_orig	context65	categ	categ_ignoring_null_categ	gene_idx	pat_idx
ABCD3	5825	broad.mit.edu	37	1	94953473	94953473	+	Missense_Mutation	SNP	T	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:94953473T>C	uc001dqn.3	+	13	1193	c.1091T>C	c.(1090-1092)CTT>CCT	p.L364P	ABCD3_uc010oto.1_Missense_Mutation_p.L388P|ABCD3_uc010otp.1_Missense_Mutation_p.L291P|ABCD3_uc009wdr.2_Intron|ABCD3_uc001dqo.3_Missense_Mutation_p.L52P	NM_002858	NP_002849	P28288	ABCD3_HUMAN	ATP-binding cassette, sub-family D, member 3	364	ABC transmembrane type-1.				peroxisomal long-chain fatty acid import|peroxisome organization	cytosol|integral to peroxisomal membrane	ATP binding|ATPase activity, coupled to transmembrane movement of substances			skin(1)	1		all_lung(203;0.000434)|Lung NSC(277;0.0019)		all cancers(265;0.0261)|Epithelial(280;0.165)		GGAAGAATGCTTTTGCGAATG	0.333													9	88	---	---	---	---	capture	Missense_Mutation	SNP	94953473	94953473	ABCD3	1	T	C	C	C	1	0	0	0	0	1	0	0	0	728	56	3	3	62	240
NOTCH2	4853	broad.mit.edu	37	1	120464949	120464949	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:120464949G>C	uc001eik.2	-	28	5379	c.5123C>G	c.(5122-5124)TCT>TGT	p.S1708C		NM_024408	NP_077719	Q04721	NOTC2_HUMAN	notch 2 preproprotein	1708	Cytoplasmic (Potential).				anti-apoptosis|bone remodeling|cell cycle arrest|cell fate determination|cell growth|hemopoiesis|induction of apoptosis|negative regulation of cell proliferation|nervous system development|Notch receptor processing|Notch signaling pathway|organ morphogenesis|positive regulation of Ras protein signal transduction|regulation of transcription, DNA-dependent|stem cell maintenance|transcription, DNA-dependent	cell surface|cytosol|endoplasmic reticulum lumen|extracellular region|Golgi lumen|integral to plasma membrane|nucleoplasm	calcium ion binding|ligand-regulated transcription factor activity|protein binding|receptor activity			lung(8)|haematopoietic_and_lymphoid_tissue(7)|ovary(4)|central_nervous_system(2)|skin(2)|kidney(2)|breast(1)|prostate(1)	27	all_neural(166;0.153)	all_lung(203;1.96e-06)|Lung NSC(69;1.47e-05)|all_epithelial(167;0.000809)		Lung(183;0.0242)|LUSC - Lung squamous cell carcinoma(189;0.133)		CAGCCAGAGAGAGCCATGCTT	0.512			N|F|Mis		marginal zone lymphoma|DLBCL				Alagille_Syndrome				21	52	---	---	---	---	capture	Missense_Mutation	SNP	120464949	120464949	NOTCH2	1	G	C	C	C	1	0	0	0	0	1	0	0	0	429	33	4	4	10455	240
FLG	2312	broad.mit.edu	37	1	152278815	152278815	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:152278815G>A	uc001ezu.1	-	3	8583	c.8547C>T	c.(8545-8547)GAC>GAT	p.D2849D		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2849	Ser-rich.|Filaggrin 17.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			GCCTGGAGCCGTCTCCTGATT	0.567									Ichthyosis				139	764	---	---	---	---	capture	Silent	SNP	152278815	152278815	FLG	1	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	5867	240
FLG	2312	broad.mit.edu	37	1	152280892	152280892	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:152280892G>A	uc001ezu.1	-	3	6506	c.6470C>T	c.(6469-6471)TCG>TTG	p.S2157L		NM_002016	NP_002007	P20930	FILA_HUMAN	filaggrin	2157	Ser-rich.				keratinocyte differentiation	cytoplasmic membrane-bounded vesicle|intermediate filament	calcium ion binding|structural molecule activity			ovary(9)|skin(4)|upper_aerodigestive_tract(3)	16	Hepatocellular(266;0.0877)|Melanoma(130;0.116)|all_hematologic(923;0.127)		LUSC - Lung squamous cell carcinoma(543;0.206)			CCTATCTACCGATTGCTCTTG	0.597									Ichthyosis				284	507	---	---	---	---	capture	Missense_Mutation	SNP	152280892	152280892	FLG	1	G	A	A	A	1	0	0	0	0	1	0	0	0	481	37	1	1	5867	240
SPTA1	6708	broad.mit.edu	37	1	158614180	158614180	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:158614180G>C	uc001fst.1	-	30	4400	c.4201C>G	c.(4201-4203)CAG>GAG	p.Q1401E		NM_003126	NP_003117	P02549	SPTA1_HUMAN	spectrin, alpha, erythrocytic 1	1401	Spectrin 14.				actin filament capping|actin filament organization|axon guidance|regulation of cell shape	cytosol|intrinsic to internal side of plasma membrane|spectrin|spectrin-associated cytoskeleton	actin filament binding|calcium ion binding|structural constituent of cytoskeleton			ovary(4)|skin(2)|upper_aerodigestive_tract(1)|breast(1)	8	all_hematologic(112;0.0378)					CAGTTCCCCTGGAACATCTAT	0.453													28	83	---	---	---	---	capture	Missense_Mutation	SNP	158614180	158614180	SPTA1	1	G	C	C	C	1	0	0	0	0	1	0	0	0	611	47	4	4	15008	240
F5	2153	broad.mit.edu	37	1	169525893	169525893	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:169525893G>A	uc001ggg.1	-	6	1088	c.943C>T	c.(943-945)CAT>TAT	p.H315Y	F5_uc010plr.1_RNA	NM_000130	NP_000121	P12259	FA5_HUMAN	coagulation factor V precursor	315	F5/8 type A 1.|Plastocyanin-like 2.				cell adhesion|platelet activation|platelet degranulation	plasma membrane|platelet alpha granule lumen	copper ion binding|oxidoreductase activity			ovary(3)|large_intestine(1)|central_nervous_system(1)|skin(1)	6	all_hematologic(923;0.208)				Drotrecogin alfa(DB00055)	CCTTGCAAATGTTTTGGGGTG	0.483													6	80	---	---	---	---	capture	Missense_Mutation	SNP	169525893	169525893	F5	1	G	A	A	A	1	0	0	0	0	1	0	0	0	624	48	2	2	5302	240
RGL1	23179	broad.mit.edu	37	1	183849845	183849845	+	Missense_Mutation	SNP	A	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:183849845A>C	uc001gqo.2	+	5	678	c.521A>C	c.(520-522)TAT>TCT	p.Y174S	RGL1_uc010pof.1_Intron|RGL1_uc001gqm.2_Missense_Mutation_p.Y209S|RGL1_uc010pog.1_Missense_Mutation_p.Y172S|RGL1_uc010poh.1_Missense_Mutation_p.Y172S|RGL1_uc010poi.1_Missense_Mutation_p.Y174S	NM_015149	NP_055964	Q9NZL6	RGL1_HUMAN	ral guanine nucleotide dissociation	174	N-terminal Ras-GEF.		Y -> S (in a breast cancer sample; somatic mutation).		cellular lipid metabolic process|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	protein binding|Ral guanyl-nucleotide exchange factor activity	p.Y209S(2)		breast(5)|ovary(4)|lung(2)	11						CTGCTGGATTATCTCACACGG	0.498													68	70	---	---	---	---	capture	Missense_Mutation	SNP	183849845	183849845	RGL1	1	A	C	C	C	1	0	0	0	0	1	0	0	0	208	16	4	4	13171	240
RGL1	23179	broad.mit.edu	37	1	183849848	183849848	+	Missense_Mutation	SNP	T	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:183849848T>A	uc001gqo.2	+	5	681	c.524T>A	c.(523-525)CTC>CAC	p.L175H	RGL1_uc010pof.1_Intron|RGL1_uc001gqm.2_Missense_Mutation_p.L210H|RGL1_uc010pog.1_Missense_Mutation_p.L173H|RGL1_uc010poh.1_Missense_Mutation_p.L173H|RGL1_uc010poi.1_Missense_Mutation_p.L175H	NM_015149	NP_055964	Q9NZL6	RGL1_HUMAN	ral guanine nucleotide dissociation	175	N-terminal Ras-GEF.				cellular lipid metabolic process|regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	intracellular	protein binding|Ral guanyl-nucleotide exchange factor activity			breast(5)|ovary(4)|lung(2)	11						CTGGATTATCTCACACGGATG	0.488													68	73	---	---	---	---	capture	Missense_Mutation	SNP	183849848	183849848	RGL1	1	T	A	A	A	1	0	0	0	0	1	0	0	0	702	54	4	4	13171	240
ASPM	259266	broad.mit.edu	37	1	197112574	197112574	+	Missense_Mutation	SNP	A	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr1:197112574A>G	uc001gtu.2	-	3	1065	c.808T>C	c.(808-810)TCT>CCT	p.S270P	ASPM_uc001gtv.2_Missense_Mutation_p.S270P|ASPM_uc001gtw.3_Intron	NM_018136	NP_060606	Q8IZT6	ASPM_HUMAN	asp (abnormal spindle)-like, microcephaly	270					mitosis	cytoplasm|nucleus	calmodulin binding			ovary(4)|central_nervous_system(2)	6						TCATTAAAAGAAACTTTTGAA	0.378													84	112	---	---	---	---	capture	Missense_Mutation	SNP	197112574	197112574	ASPM	1	A	G	G	G	1	0	0	0	0	1	0	0	0	117	9	3	3	1047	240
ANO9	338440	broad.mit.edu	37	11	433453	433453	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:433453G>A	uc001lpi.2	-	4	296	c.211C>T	c.(211-213)CGG>TGG	p.R71W	ANO9_uc010qvv.1_5'UTR	NM_001012302	NP_001012302	A1A5B4	ANO9_HUMAN	tumor protein p53 inducible protein 5	71	Cytoplasmic (Potential).					chloride channel complex	chloride channel activity			central_nervous_system(2)|ovary(1)|skin(1)	4						TTCTGGTCCCGGATCACCTGG	0.612													13	68	---	---	---	---	capture	Missense_Mutation	SNP	433453	433453	ANO9	11	G	A	A	A	1	0	0	0	0	1	0	0	0	506	39	1	1	698	240
TTC17	55761	broad.mit.edu	37	11	43464880	43464880	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:43464880G>A	uc001mxi.2	+	17	2271	c.2257G>A	c.(2257-2259)GTG>ATG	p.V753M	TTC17_uc001mxh.2_Missense_Mutation_p.V810M|TTC17_uc010rfj.1_Missense_Mutation_p.V753M|TTC17_uc001mxj.2_Missense_Mutation_p.V580M	NM_018259	NP_060729	Q96AE7	TTC17_HUMAN	tetratricopeptide repeat domain 17	753							binding			ovary(5)	5						TTCAGGTACGGTGGTTGAGGA	0.308													27	60	---	---	---	---	capture	Missense_Mutation	SNP	43464880	43464880	TTC17	11	G	A	A	A	1	0	0	0	0	1	0	0	0	572	44	2	2	16566	240
OR4X1	390113	broad.mit.edu	37	11	48285739	48285739	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:48285739G>A	uc010rht.1	+	1	327	c.327G>A	c.(325-327)GAG>GAA	p.E109E		NM_001004726	NP_001004726	Q8NH49	OR4X1_HUMAN	olfactory receptor, family 4, subfamily X,	109	Helical; Name=3; (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			ovary(1)|pancreas(1)|skin(1)	3						GTGGCACTGAGGCCTTTCTCC	0.507													29	43	---	---	---	---	capture	Silent	SNP	48285739	48285739	OR4X1	11	G	A	A	A	1	0	0	0	0	0	0	0	1	451	35	2	2	10988	240
ACY3	91703	broad.mit.edu	37	11	67413173	67413173	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:67413173C>T	uc001omq.2	-	4	593	c.422G>A	c.(421-423)CGC>CAC	p.R141H		NM_080658	NP_542389	Q96HD9	ACY3_HUMAN	aspartoacylase 3	141					interspecies interaction between organisms	apical plasma membrane|cytoplasm	hydrolase activity, acting on ester bonds|metal ion binding				0					L-Aspartic Acid(DB00128)	CTGCAGATGGCGGCACAGGTG	0.617													24	52	---	---	---	---	capture	Missense_Mutation	SNP	67413173	67413173	ACY3	11	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	227	240
RELT	84957	broad.mit.edu	37	11	73102204	73102204	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:73102204G>C	uc001otv.2	+	5	468	c.303G>C	c.(301-303)TGG>TGC	p.W101C	RELT_uc001otw.2_Missense_Mutation_p.W101C|RELT_uc009yto.1_Missense_Mutation_p.W19C|RELT_uc001otx.2_5'Flank	NM_152222	NP_689408	Q969Z4	TR19L_HUMAN	RELT tumor necrosis factor receptor precursor	101	Extracellular (Potential).					cytoplasm|integral to membrane|plasma membrane	binding|receptor activity			upper_aerodigestive_tract(1)	1						TTGGGCCTTGGGGGGTTCCCC	0.587													55	96	---	---	---	---	capture	Missense_Mutation	SNP	73102204	73102204	RELT	11	G	C	C	C	1	0	0	0	0	1	0	0	0	559	43	4	4	13116	240
OR6M1	390261	broad.mit.edu	37	11	123676770	123676770	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr11:123676770C>T	uc010rzz.1	-	1	288	c.288G>A	c.(286-288)ATG>ATA	p.M96I		NM_001005325	NP_001005325	Q8NGM8	OR6M1_HUMAN	olfactory receptor, family 6, subfamily M,	96	Extracellular (Potential).				sensory perception of smell	integral to membrane|plasma membrane	olfactory receptor activity			skin(2)	2		Breast(109;0.0109)|Medulloblastoma(222;0.0523)|Lung NSC(97;0.118)|all_lung(97;0.126)|all_neural(223;0.224)		BRCA - Breast invasive adenocarcinoma(274;4.88e-06)|OV - Ovarian serous cystadenocarcinoma(99;0.028)		ATGTTTGGATCATGCAACCAG	0.458													21	49	---	---	---	---	capture	Missense_Mutation	SNP	123676770	123676770	OR6M1	11	C	T	T	T	1	0	0	0	0	1	0	0	0	377	29	2	2	11109	240
CNTN1	1272	broad.mit.edu	37	12	41333137	41333137	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:41333137C>T	uc001rmm.1	+	12	1342	c.1229C>T	c.(1228-1230)GCG>GTG	p.A410V	CNTN1_uc009zjy.1_Missense_Mutation_p.A410V|CNTN1_uc001rmn.1_Missense_Mutation_p.A399V|CNTN1_uc001rmo.2_Missense_Mutation_p.A410V	NM_001843	NP_001834	Q12860	CNTN1_HUMAN	contactin 1 isoform 1 precursor	410					axon guidance|cell adhesion|Notch signaling pathway	anchored to membrane|membrane fraction|plasma membrane				lung(4)|ovary(3)|large_intestine(1)|skin(1)	9	all_cancers(12;2.07e-06)|all_epithelial(1;4.26e-06)|Breast(8;0.0716)	Lung NSC(34;0.0211)|all_lung(34;0.0294)				TTCTTTTTAGCGTTGGCTCCA	0.348													4	74	---	---	---	---	capture	Missense_Mutation	SNP	41333137	41333137	CNTN1	12	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	3605	240
TRHDE	29953	broad.mit.edu	37	12	72771778	72771778	+	Nonsense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:72771778C>T	uc001sxa.2	+	3	1087	c.1057C>T	c.(1057-1059)CGA>TGA	p.R353*		NM_013381	NP_037513	Q9UKU6	TRHDE_HUMAN	thyrotropin-releasing hormone degrading enzyme	353	Extracellular (Potential).				cell-cell signaling|proteolysis|signal transduction	integral to plasma membrane	aminopeptidase activity|metallopeptidase activity|zinc ion binding			ovary(2)|skin(1)	3						taattaGGTACGATTATATGC	0.308													17	45	---	---	---	---	capture	Nonsense_Mutation	SNP	72771778	72771778	TRHDE	12	C	T	T	T	1	0	0	0	0	0	1	0	0	243	19	5	1	16362	240
TBX5	6910	broad.mit.edu	37	12	114793581	114793581	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr12:114793581C>T	uc001tvo.2	-	9	1808	c.1313G>A	c.(1312-1314)CGG>CAG	p.R438Q	TBX5_uc001tvp.2_Missense_Mutation_p.R438Q|TBX5_uc001tvq.2_Missense_Mutation_p.R388Q	NM_181486	NP_852259	Q99593	TBX5_HUMAN	T-box 5 isoform 1	438				MDRLPYQHFSAHFTSGPLVPRLAGMANHGSPQLGEGMFQHQ TS -> WTGYPTSTSPLTSPRGPWSLGWLAWQPWLPTAGRG NVPSTRPP (in Ref. 1; CAA70592).	cardiac left ventricle formation|cell migration involved in coronary vasculogenesis|cell-cell signaling|embryonic arm morphogenesis|induction of apoptosis|negative regulation of cardiac muscle cell proliferation|negative regulation of cell migration|negative regulation of epithelial to mesenchymal transition|pericardium development|positive regulation of cardioblast differentiation|positive regulation of transcription from RNA polymerase II promoter|ventricular septum development	cytoplasm|nucleus	protein binding|sequence-specific DNA binding|sequence-specific DNA binding transcription factor activity|transcription factor binding			ovary(6)|pancreas(1)|skin(1)	8	Medulloblastoma(191;0.163)|all_neural(191;0.178)			BRCA - Breast invasive adenocarcinoma(302;0.0893)		GCCAGCCAGCCGAGGGACCAG	0.657													4	30	---	---	---	---	capture	Missense_Mutation	SNP	114793581	114793581	TBX5	12	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	15548	240
CLYBL	171425	broad.mit.edu	37	13	100425234	100425234	+	Missense_Mutation	SNP	C	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr13:100425234C>G	uc001vok.2	+	2	233	c.219C>G	c.(217-219)GAC>GAG	p.D73E	CLYBL_uc010tix.1_Missense_Mutation_p.D73E|CLYBL_uc010tiy.1_Missense_Mutation_p.D73E	NM_206808	NP_996531	Q8N0X4	CLYBL_HUMAN	citrate lyase beta like precursor	73					cellular aromatic compound metabolic process	citrate lyase complex|mitochondrion	citrate (pro-3S)-lyase activity|metal ion binding				0	all_neural(89;0.0837)|Medulloblastoma(90;0.18)|Lung SC(71;0.184)					CAGTGCTCGACTGTGAGGATG	0.398													10	92	---	---	---	---	capture	Missense_Mutation	SNP	100425234	100425234	CLYBL	13	C	G	G	G	1	0	0	0	0	1	0	0	0	259	20	4	4	3538	240
ATP11A	23250	broad.mit.edu	37	13	113485796	113485796	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr13:113485796C>T	uc001vsi.3	+	13	1417	c.1329C>T	c.(1327-1329)AAC>AAT	p.N443N	ATP11A_uc001vsj.3_Silent_p.N443N|ATP11A_uc001vsm.1_Silent_p.N319N	NM_015205	NP_056020	P98196	AT11A_HUMAN	ATPase, class VI, type 11A isoform a	443	Cytoplasmic (Potential).				ATP biosynthetic process	integral to membrane	ATP binding|ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism|magnesium ion binding|phospholipid-translocating ATPase activity			large_intestine(2)|ovary(2)	4	all_lung(23;0.000374)|Lung NSC(43;0.0107)|Lung SC(71;0.0753)|all_neural(89;0.0804)|Hepatocellular(20;0.0877)|Medulloblastoma(90;0.163)	all_lung(25;0.134)|all_epithelial(44;0.141)				TCATCTGCAACGGGCAGGTCC	0.587													12	35	---	---	---	---	capture	Silent	SNP	113485796	113485796	ATP11A	13	C	T	T	T	1	0	0	0	0	0	0	0	1	246	19	1	1	1110	240
MYH7	4625	broad.mit.edu	37	14	23883029	23883029	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr14:23883029G>A	uc001wjx.2	-	39	5835	c.5729C>T	c.(5728-5730)GCG>GTG	p.A1910V		NM_000257	NP_000248	P12883	MYH7_HUMAN	myosin, heavy chain 7, cardiac muscle, beta	1910	Potential.				adult heart development|muscle filament sliding|regulation of heart rate|ventricular cardiac muscle tissue morphogenesis	focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(3)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00725)		GGCGATGTCCGCCCGCTCCTC	0.622													28	95	---	---	---	---	capture	Missense_Mutation	SNP	23883029	23883029	MYH7	14	G	A	A	A	1	0	0	0	0	1	0	0	0	494	38	1	1	9949	240
MYH7	4625	broad.mit.edu	37	14	23902877	23902877	+	Missense_Mutation	SNP	T	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr14:23902877T>C	uc001wjx.2	-	3	171	c.65A>G	c.(64-66)GAG>GGG	p.E22G		NM_000257	NP_000248	P12883	MYH7_HUMAN	myosin, heavy chain 7, cardiac muscle, beta	22	Myosin head-like.				adult heart development|muscle filament sliding|regulation of heart rate|ventricular cardiac muscle tissue morphogenesis	focal adhesion|muscle myosin complex|myosin filament|nucleus|sarcomere	actin binding|actin-dependent ATPase activity|ATP binding|calmodulin binding|microfilament motor activity|structural constituent of muscle			ovary(3)|skin(1)	4	all_cancers(95;2.54e-05)			GBM - Glioblastoma multiforme(265;0.00725)		TTCTAGCCGCTCCTTCTCTGA	0.577													4	130	---	---	---	---	capture	Missense_Mutation	SNP	23902877	23902877	MYH7	14	T	C	C	C	1	0	0	0	0	1	0	0	0	702	54	3	3	9949	240
LTBP2	4053	broad.mit.edu	37	14	74992813	74992813	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr14:74992813G>A	uc001xqa.2	-	14	2780	c.2393C>T	c.(2392-2394)ACG>ATG	p.T798M		NM_000428	NP_000419	Q14767	LTBP2_HUMAN	latent transforming growth factor beta binding	798					protein secretion|protein targeting|transforming growth factor beta receptor signaling pathway	extracellular space|proteinaceous extracellular matrix	calcium ion binding|growth factor binding			liver(1)|skin(1)	2				BRCA - Breast invasive adenocarcinoma(234;0.00219)|READ - Rectum adenocarcinoma(1;0.0649)		GACACTGGTCGTGACCTGCAC	0.577													6	17	---	---	---	---	capture	Missense_Mutation	SNP	74992813	74992813	LTBP2	14	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	8989	240
NRXN3	9369	broad.mit.edu	37	14	79181464	79181464	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr14:79181464G>C	uc001xun.2	+	5	1398	c.907G>C	c.(907-909)GGA>CGA	p.G303R	NRXN3_uc001xum.1_RNA|NRXN3_uc010asv.1_Missense_Mutation_p.G437R	NM_004796	NP_004787	Q9Y4C0	NRX3A_HUMAN	neurexin 3 isoform 1 precursor	676	EGF-like 2.|Extracellular (Potential).				axon guidance|cell adhesion	integral to plasma membrane	metal ion binding|receptor activity			ovary(3)|upper_aerodigestive_tract(2)|pancreas(2)|central_nervous_system(1)|breast(1)|skin(1)	10		Renal(4;0.00876)		BRCA - Breast invasive adenocarcinoma(234;0.00544)|Kidney(3;0.029)|KIRC - Kidney renal clear cell carcinoma(182;0.223)		CGGATACTGGGGAAGAACCTG	0.587													21	60	---	---	---	---	capture	Missense_Mutation	SNP	79181464	79181464	NRXN3	14	G	C	C	C	1	0	0	0	0	1	0	0	0	559	43	4	4	10574	240
TDRD9	122402	broad.mit.edu	37	14	104481128	104481128	+	Nonsense_Mutation	SNP	C	T	T	rs143367834		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr14:104481128C>T	uc001yom.3	+	21	2203	c.2173C>T	c.(2173-2175)CGA>TGA	p.R725*	TDRD9_uc001yon.3_Nonsense_Mutation_p.R463*	NM_153046	NP_694591	Q8NDG6	TDRD9_HUMAN	tudor domain containing 9	725					cell differentiation|DNA methylation involved in gamete generation|fertilization|gene silencing by RNA|male meiosis|multicellular organismal development|piRNA metabolic process|spermatogenesis	nucleus|piP-body	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(2)|central_nervous_system(1)	3		all_cancers(154;0.109)|Melanoma(154;0.0525)|all_epithelial(191;0.0768)				TGATTCTCGGCGACCTGTCAT	0.368													65	142	---	---	---	---	capture	Nonsense_Mutation	SNP	104481128	104481128	TDRD9	14	C	T	T	T	1	0	0	0	0	0	1	0	0	347	27	5	1	15621	240
NDN	4692	broad.mit.edu	37	15	23931758	23931758	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr15:23931758G>A	uc001ywk.2	-	1	693	c.607C>T	c.(607-609)CGC>TGC	p.R203C		NM_002487	NP_002478	Q99608	NECD_HUMAN	necdin	203	MAGE.				negative regulation of cell proliferation|regulation of growth|regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus|perikaryon	DNA binding				0		all_cancers(20;1.78e-24)|all_epithelial(15;7.75e-22)|Lung NSC(15;2.96e-18)|all_lung(15;2.8e-17)|Breast(32;0.000625)|Colorectal(260;0.14)		all cancers(64;8.37e-11)|Epithelial(43;9.29e-10)|BRCA - Breast invasive adenocarcinoma(123;0.00179)|GBM - Glioblastoma multiforme(186;0.018)|Lung(196;0.153)		CTGGCGCCGCGGCCCTTCACG	0.662									Prader-Willi_syndrome				11	31	---	---	---	---	capture	Missense_Mutation	SNP	23931758	23931758	NDN	15	G	A	A	A	1	0	0	0	0	1	0	0	0	507	39	1	1	10154	240
CSPG4	1464	broad.mit.edu	37	15	75980642	75980642	+	Missense_Mutation	SNP	G	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr15:75980642G>T	uc002baw.2	-	3	2857	c.2764C>A	c.(2764-2766)CTC>ATC	p.L922I		NM_001897	NP_001888	Q6UVK1	CSPG4_HUMAN	chondroitin sulfate proteoglycan 4 precursor	922	Interaction with COL5A1 (By similarity).|Extracellular (Potential).|Gly/Ser-rich (glycosaminoglycan attachment domain).|CSPG 5.|Interaction with COL6A2 (By similarity).				angiogenesis|cell differentiation|intracellular signal transduction|positive regulation of peptidyl-tyrosine phosphorylation|tissue remodeling	apical plasma membrane|cell surface|integral to plasma membrane|intracellular|lamellipodium membrane	protein kinase binding|signal transducer activity			ovary(2)|pancreas(1)	3						TTGACAAAGAGGTGGTCAGCA	0.597													4	180	---	---	---	---	capture	Missense_Mutation	SNP	75980642	75980642	CSPG4	15	G	T	T	T	1	0	0	0	0	1	0	0	0	455	35	4	4	3925	240
SYNM	23336	broad.mit.edu	37	15	99669677	99669677	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr15:99669677G>A	uc002bup.2	+	6	1232	c.1112G>A	c.(1111-1113)AGC>AAC	p.S371N	SYNM_uc002buo.2_Missense_Mutation_p.S371N|SYNM_uc002buq.2_Intron	NM_145728	NP_663780	O15061	SYNEM_HUMAN	desmuslin isoform A	371	Tail.				intermediate filament cytoskeleton organization	adherens junction|costamere|intermediate filament|neurofilament cytoskeleton	intermediate filament binding|structural constituent of cytoskeleton|structural constituent of muscle|vinculin binding			ovary(3)|central_nervous_system(1)	4						TTCAATCACAGCTCGGCACTG	0.463													5	295	---	---	---	---	capture	Missense_Mutation	SNP	99669677	99669677	SYNM	15	G	A	A	A	1	0	0	0	0	1	0	0	0	442	34	2	2	15343	240
GRIN2A	2903	broad.mit.edu	37	16	9943739	9943739	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:9943739G>A	uc002czo.3	-	5	1750	c.1202C>T	c.(1201-1203)CCG>CTG	p.P401L	GRIN2A_uc010uym.1_Missense_Mutation_p.P401L|GRIN2A_uc010uyn.1_Missense_Mutation_p.P244L|GRIN2A_uc002czr.3_Missense_Mutation_p.P401L	NM_001134407	NP_001127879	Q12879	NMDE1_HUMAN	N-methyl-D-aspartate receptor subunit 2A isoform	401	Extracellular (Potential).				response to ethanol	cell junction|N-methyl-D-aspartate selective glutamate receptor complex|outer membrane-bounded periplasmic space|postsynaptic membrane	N-methyl-D-aspartate selective glutamate receptor activity|zinc ion binding			skin(32)|NS(5)|ovary(4)|large_intestine(1)|lung(1)|breast(1)|kidney(1)	45					Felbamate(DB00949)|Glycine(DB00145)|L-Glutamic Acid(DB00142)|Loperamide(DB00836)|Memantine(DB01043)	GTTGTCATCCGGCTCACAGTC	0.587													46	83	---	---	---	---	capture	Missense_Mutation	SNP	9943739	9943739	GRIN2A	16	G	A	A	A	1	0	0	0	0	1	0	0	0	507	39	1	1	6712	240
HYDIN	54768	broad.mit.edu	37	16	70866858	70866858	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:70866858C>T	uc002ezr.2	-	80	13917	c.13789G>A	c.(13789-13791)GTG>ATG	p.V4597M	HYDIN_uc010cfy.2_RNA	NM_032821	NP_116210	Q4G0P3	HYDIN_HUMAN	hydrocephalus inducing isoform a	4598										ovary(1)|skin(1)	2		Ovarian(137;0.0654)				TCCTTTCCCACCTCGGTGGGA	0.493													17	36	---	---	---	---	capture	Missense_Mutation	SNP	70866858	70866858	HYDIN	16	C	T	T	T	1	0	0	0	0	1	0	0	0	234	18	2	2	7392	240
PRDM7	11105	broad.mit.edu	37	16	90128375	90128375	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr16:90128375C>T	uc010cje.2	-	7	856	c.836G>A	c.(835-837)CGA>CAA	p.R279Q	PRDM7_uc002fqo.2_Missense_Mutation_p.R73Q|PRDM7_uc010cjf.2_Missense_Mutation_p.R162Q|PRDM7_uc010cjg.1_Missense_Mutation_p.R73Q|PRDM7_uc010cjh.1_RNA	NM_001098173	NP_001091643	Q9NQW5	PRDM7_HUMAN	PR domain containing 7 isoform 1	279	SET.					chromosome|nucleus	nucleic acid binding			ovary(1)	1		all_cancers(9;4.44e-13)|Lung NSC(15;1.56e-06)|all_lung(18;2.18e-06)|all_neural(9;0.00118)|all_hematologic(23;0.0194)		BRCA - Breast invasive adenocarcinoma(80;0.0278)		TTCTGTAATTCGGCCCTCATA	0.547													9	177	---	---	---	---	capture	Missense_Mutation	SNP	90128375	90128375	PRDM7	16	C	T	T	T	1	0	0	0	0	1	0	0	0	403	31	1	1	12357	240
MYOCD	93649	broad.mit.edu	37	17	12626268	12626268	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:12626268G>A	uc002gnn.2	+	5	657	c.358G>A	c.(358-360)GAG>AAG	p.E120K	MYOCD_uc002gno.2_Missense_Mutation_p.E120K|MYOCD_uc002gnp.1_Missense_Mutation_p.E24K	NM_153604	NP_705832	Q8IZQ8	MYCD_HUMAN	myocardin isoform 2	120	RPEL 3.				cardiac muscle cell differentiation|negative regulation of cell proliferation|negative regulation of cyclin-dependent protein kinase activity|positive regulation of smooth muscle cell differentiation|positive regulation of smooth muscle contraction|positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation|regulation of histone acetylation|smooth muscle cell differentiation	nucleus	nucleic acid binding|RNA polymerase II transcription factor binding transcription factor activity|transcription factor binding			central_nervous_system(2)|skin(2)|ovary(1)	5				UCEC - Uterine corpus endometrioid carcinoma (92;0.0969)		AGGGCCACTGGAGCTGGTGGA	0.468													5	196	---	---	---	---	capture	Missense_Mutation	SNP	12626268	12626268	MYOCD	17	G	A	A	A	1	0	0	0	0	1	0	0	0	533	41	2	2	9997	240
CCL14	6358	broad.mit.edu	37	17	34311432	34311432	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:34311432G>A	uc010wcr.1	-	2	215	c.136C>T	c.(136-138)CGT>TGT	p.R46C	CCL16_uc002hkl.2_5'Flank|CCL16_uc002hkm.2_5'Flank|CCL14_uc010wcq.1_Missense_Mutation_p.R62C|CCL14_uc002hkn.2_RNA|CCL14-CCL15_uc010wcs.1_RNA|CCL14-CCL15_uc010wct.1_RNA|uc002hkq.2_5'Flank	NM_032963	NP_116739	Q16627	CCL14_HUMAN	chemokine (C-C motif) ligand 14 isoform 1	46					cellular calcium ion homeostasis|immune response|positive regulation of cell proliferation	extracellular space	chemokine activity|signal transducer activity				0		Ovarian(249;0.17)		UCEC - Uterine corpus endometrioid carcinoma (308;0.0182)		ATCCGCTGACGCGGGATCTTG	0.552													23	61	---	---	---	---	capture	Missense_Mutation	SNP	34311432	34311432	CCL14	17	G	A	A	A	1	0	0	0	0	1	0	0	0	494	38	1	1	2858	240
KRT38	8687	broad.mit.edu	37	17	39597030	39597030	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:39597030G>A	uc002hwq.1	-	1	567	c.144C>T	c.(142-144)AAC>AAT	p.N48N		NM_006771	NP_006762	O76015	KRT38_HUMAN	keratin 38	48	Head.					intermediate filament	structural molecule activity			skin(2)	2		Breast(137;0.000496)				CATGTGCCACGTTGGCCAAAA	0.632													37	53	---	---	---	---	capture	Silent	SNP	39597030	39597030	KRT38	17	G	A	A	A	1	0	0	0	0	0	0	0	1	516	40	1	1	8395	240
ABCA9	10350	broad.mit.edu	37	17	67041451	67041451	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:67041451C>T	uc002jhu.2	-	4	474	c.331G>A	c.(331-333)GAA>AAA	p.E111K	ABCA9_uc010dez.2_Missense_Mutation_p.E111K|ABCA9_uc002jhv.2_Missense_Mutation_p.E111K	NM_080283	NP_525022	Q8IUA7	ABCA9_HUMAN	ATP-binding cassette, sub-family A, member 9	111					transport	integral to membrane	ATP binding|ATPase activity			ovary(4)|upper_aerodigestive_tract(1)|central_nervous_system(1)	6	Breast(10;1.47e-12)					ATGCTTTTTTCATCAGGCCAC	0.383													24	144	---	---	---	---	capture	Missense_Mutation	SNP	67041451	67041451	ABCA9	17	C	T	T	T	1	0	0	0	0	1	0	0	0	377	29	2	2	39	240
POTEC	388468	broad.mit.edu	37	18	14513764	14513764	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr18:14513764C>T	uc010dln.2	-	10	1884	c.1430G>A	c.(1429-1431)CGG>CAG	p.R477Q	POTEC_uc010xaj.1_RNA	NM_001137671	NP_001131143	B2RU33	POTEC_HUMAN	ANKRD26-like family B, member 2	477										skin(3)	3						AAGTTGTTTCCGGGTATCATT	0.358													4	94	---	---	---	---	capture	Missense_Mutation	SNP	14513764	14513764	POTEC	18	C	T	T	T	1	0	0	0	0	1	0	0	0	299	23	1	1	12164	240
CABYR	26256	broad.mit.edu	37	18	21735681	21735681	+	Missense_Mutation	SNP	A	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr18:21735681A>T	uc002kux.2	+	4	368	c.216A>T	c.(214-216)GAA>GAT	p.E72D	CABYR_uc010xbb.1_Translation_Start_Site|CABYR_uc002kuy.2_Missense_Mutation_p.E72D|CABYR_uc002kuz.2_Missense_Mutation_p.E72D|CABYR_uc002kva.2_Missense_Mutation_p.E54D|CABYR_uc002kvb.2_Translation_Start_Site|CABYR_uc002kvc.2_Missense_Mutation_p.E72D|CABYR_uc010dlw.2_RNA	NM_012189	NP_036321	O75952	CABYR_HUMAN	calcium-binding tyrosine	72					ciliary or flagellar motility|signal transduction|sperm capacitation	cytoplasm|cytoskeleton|flagellum|motile cilium|nucleus	calcium ion binding|cAMP-dependent protein kinase regulator activity|enzyme binding|protein heterodimerization activity|SH3 domain binding				0	all_cancers(21;9.13e-05)|all_epithelial(16;5.49e-07)|Lung NSC(20;0.00171)|all_lung(20;0.0055)|Colorectal(14;0.0305)|Ovarian(20;0.17)					AATGGTCAGAAGGAACGACAC	0.323													36	59	---	---	---	---	capture	Missense_Mutation	SNP	21735681	21735681	CABYR	18	A	T	T	T	1	0	0	0	0	1	0	0	0	37	3	4	4	2512	240
MEP1B	4225	broad.mit.edu	37	18	29784271	29784271	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr18:29784271G>A	uc002kxj.3	+	7	542	c.495G>A	c.(493-495)TCG>TCA	p.S165S		NM_005925	NP_005916	Q16820	MEP1B_HUMAN	meprin A beta precursor	165	Extracellular (Potential).|Metalloprotease.				digestion|proteolysis	extracellular space|integral to plasma membrane	metalloendopeptidase activity|zinc ion binding			ovary(2)	2						ATGAGCAGTCGCGTTCTGACC	0.458													7	6	---	---	---	---	capture	Silent	SNP	29784271	29784271	MEP1B	18	G	A	A	A	1	0	0	0	0	0	0	0	1	483	38	1	1	9389	240
TNFRSF11A	8792	broad.mit.edu	37	18	60017106	60017106	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr18:60017106G>A	uc002lin.2	+	3	257	c.219G>A	c.(217-219)CCG>CCA	p.P73P	TNFRSF11A_uc010dpv.2_Silent_p.P73P	NM_003839	NP_003830	Q9Y6Q6	TNR11_HUMAN	tumor necrosis factor receptor superfamily,	73	TNFR-Cys 2.|Extracellular (Potential).				adaptive immune response|cell-cell signaling|circadian temperature homeostasis|monocyte chemotaxis|osteoclast differentiation|positive regulation of cell proliferation|positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling|positive regulation of fever generation by positive regulation of prostaglandin secretion|positive regulation of JUN kinase activity|positive regulation of NF-kappaB transcription factor activity|response to interleukin-1|response to lipopolysaccharide	external side of plasma membrane|integral to membrane	metal ion binding|tumor necrosis factor receptor activity			breast(2)|lung(1)	3		Colorectal(73;0.188)				CCTGTGGCCCGGATGAATACT	0.418									Paget_Disease_of_Bone				82	198	---	---	---	---	capture	Silent	SNP	60017106	60017106	TNFRSF11A	18	G	A	A	A	1	0	0	0	0	0	0	0	1	496	39	1	1	16167	240
HMHA1	23526	broad.mit.edu	37	19	1080969	1080969	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:1080969C>T	uc002lqz.1	+	17	2327	c.2096C>T	c.(2095-2097)GCG>GTG	p.A699V	HMHA1_uc010xgd.1_Missense_Mutation_p.A715V|HMHA1_uc010xge.1_Missense_Mutation_p.A567V|HMHA1_uc002lra.1_Missense_Mutation_p.A539V|HMHA1_uc002lrb.1_Missense_Mutation_p.A582V|HMHA1_uc002lrc.1_Missense_Mutation_p.A334V|HMHA1_uc002lrd.1_5'Flank|HMHA1_uc010dsd.1_5'Flank	NM_012292	NP_036424	Q92619	HMHA1_HUMAN	minor histocompatibility antigen HA-1	699					regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol	GTPase activator activity|metal ion binding			lung(1)	1		Acute lymphoblastic leukemia(61;2.53e-14)|all_hematologic(61;8.18e-10)|Lung NSC(49;1.04e-05)|all_lung(49;1.53e-05)|Breast(49;9.42e-05)|Hepatocellular(1079;0.137)		UCEC - Uterine corpus endometrioid carcinoma (162;6.64e-05)|OV - Ovarian serous cystadenocarcinoma(105;1.09e-113)|Epithelial(107;3.79e-112)|all cancers(105;1.67e-104)|BRCA - Breast invasive adenocarcinoma(158;0.00136)|STAD - Stomach adenocarcinoma(1328;0.18)		CTGTCCAAGGCGGCCCGTACT	0.682													6	12	---	---	---	---	capture	Missense_Mutation	SNP	1080969	1080969	HMHA1	19	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	7165	240
RDH8	50700	broad.mit.edu	37	19	10131987	10131987	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:10131987C>T	uc002mmr.2	+	5	842	c.593C>T	c.(592-594)GCG>GTG	p.A198V		NM_015725	NP_056540	Q9NYR8	RDH8_HUMAN	retinol dehydrogenase 8 (all-trans)	198					estrogen biosynthetic process|response to stimulus|visual perception	cytoplasm|integral to plasma membrane	binding|estradiol 17-beta-dehydrogenase activity|NADP-retinol dehydrogenase activity|retinol dehydrogenase activity			ovary(3)|pancreas(1)	4			Epithelial(33;4.24e-05)		Vitamin A(DB00162)	AAGCTTCTGGCGCAGGTTTCT	0.602													53	95	---	---	---	---	capture	Missense_Mutation	SNP	10131987	10131987	RDH8	19	C	T	T	T	1	0	0	0	0	1	0	0	0	351	27	1	1	13091	240
CYP4F22	126410	broad.mit.edu	37	19	15651449	15651449	+	Missense_Mutation	SNP	G	A	A	rs146265982		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:15651449G>A	uc002nbh.3	+	8	1027	c.860G>A	c.(859-861)CGT>CAT	p.R287H		NM_173483	NP_775754	Q6NT55	CP4FN_HUMAN	cytochrome P450, family 4, subfamily F,	287						endoplasmic reticulum membrane|microsome	electron carrier activity|heme binding|monooxygenase activity|oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen			ovary(1)|pancreas(1)	2						CGGGCACTGCGTCAGCAGGGG	0.632													42	77	---	---	---	---	capture	Missense_Mutation	SNP	15651449	15651449	CYP4F22	19	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	4149	240
GTPBP3	84705	broad.mit.edu	37	19	17452117	17452117	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:17452117G>A	uc010eas.2	+	8	1304	c.1239G>A	c.(1237-1239)AAG>AAA	p.K413K	GTPBP3_uc010xpo.1_Silent_p.K435K|GTPBP3_uc002ngh.3_Silent_p.K392K|GTPBP3_uc002ngg.3_Silent_p.K445K|GTPBP3_uc002ngi.3_Silent_p.K79K	NM_032620	NP_116009	Q969Y2	GTPB3_HUMAN	GTP binding protein 3 (mitochondrial) isoform V	413					tRNA modification	mitochondrion	GTP binding|GTPase activity			skin(1)	1						CGCTGAGGAAGGAGCTAGCTG	0.572													13	31	---	---	---	---	capture	Silent	SNP	17452117	17452117	GTPBP3	19	G	A	A	A	1	0	0	0	0	0	0	0	1	451	35	2	2	6810	240
PGPEP1	54858	broad.mit.edu	37	19	18468321	18468321	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:18468321C>T	uc002nis.1	+	4	417	c.333C>T	c.(331-333)GAC>GAT	p.D111D	PGPEP1_uc002nir.1_RNA|PGPEP1_uc002nit.1_Silent_p.D34D|PGPEP1_uc010xqg.1_Silent_p.D34D	NM_017712	NP_060182	Q9NXJ5	PGPI_HUMAN	pyroglutamyl-peptidase I	111							cysteine-type peptidase activity				0						GCGTGGAGGACGGGCCTGAAA	0.592													3	43	---	---	---	---	capture	Silent	SNP	18468321	18468321	PGPEP1	19	C	T	T	T	1	0	0	0	0	0	0	0	1	246	19	1	1	11706	240
ZNF599	148103	broad.mit.edu	37	19	35250777	35250777	+	Missense_Mutation	SNP	G	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:35250777G>T	uc010edn.1	-	4	1317	c.929C>A	c.(928-930)CCC>CAC	p.P310H	ZNF599_uc010edm.1_Missense_Mutation_p.P273H	NM_001007248	NP_001007249	Q96NL3	ZN599_HUMAN	zinc finger protein 599	310					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding			ovary(1)|skin(1)	2	all_lung(56;1.13e-07)|Lung NSC(56;1.81e-07)|Esophageal squamous(110;0.162)		LUSC - Lung squamous cell carcinoma(66;0.138)			GCATAAAAAGGGTTTTTCTCG	0.418													54	129	---	---	---	---	capture	Missense_Mutation	SNP	35250777	35250777	ZNF599	19	G	T	T	T	1	0	0	0	0	1	0	0	0	559	43	4	4	17907	240
CCDC8	83987	broad.mit.edu	37	19	46914658	46914658	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:46914658C>T	uc002pep.2	-	1	2262	c.1410G>A	c.(1408-1410)AGG>AGA	p.R470R		NM_032040	NP_114429	Q9H0W5	CCDC8_HUMAN	coiled-coil domain containing 8	470						plasma membrane				ovary(3)	3				OV - Ovarian serous cystadenocarcinoma(262;4.66e-05)|all cancers(93;0.000582)|Epithelial(262;0.00428)|GBM - Glioblastoma multiforme(486;0.0421)		GTTTCCGGGCCCTGGCTCCTG	0.612													43	74	---	---	---	---	capture	Silent	SNP	46914658	46914658	CCDC8	19	C	T	T	T	1	0	0	0	0	0	0	0	1	285	22	2	2	2827	240
ZNF534	147658	broad.mit.edu	37	19	52942354	52942354	+	Silent	SNP	A	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:52942354A>G	uc002pzk.2	+	4	1741	c.1680A>G	c.(1678-1680)GAA>GAG	p.E560E	ZNF534_uc002pzj.1_Intron|ZNF534_uc010epo.1_Intron|ZNF534_uc002pzl.2_Silent_p.E547E	NM_001143939	NP_001137411	Q76KX8	ZN534_HUMAN	zinc finger protein 534 isoform 2	560					regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	DNA binding|zinc ion binding				0						ATACTGGAGAAAAGCCTTACA	0.433													3	36	---	---	---	---	capture	Silent	SNP	52942354	52942354	ZNF534	19	A	G	G	G	1	0	0	0	0	0	0	0	1	11	1	3	3	17852	240
LILRB1	10859	broad.mit.edu	37	19	55147969	55147969	+	Missense_Mutation	SNP	C	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:55147969C>A	uc002qgj.2	+	15	2012	c.1672C>A	c.(1672-1674)CAG>AAG	p.Q558K	LILRB1_uc010erp.1_3'UTR|LILRB1_uc002qgl.2_Missense_Mutation_p.Q559K|LILRB1_uc002qgk.2_Missense_Mutation_p.Q559K|LILRB1_uc002qgm.2_Missense_Mutation_p.Q560K|LILRB1_uc010erq.2_Missense_Mutation_p.Q542K|LILRB1_uc010err.2_RNA	NM_006669	NP_006660	Q8NHL6	LIRB1_HUMAN	leukocyte immunoglobulin-like receptor,	558	Cytoplasmic (Potential).				regulation of immune response|response to virus	integral to membrane|plasma membrane	protein phosphatase 1 binding|receptor activity			large_intestine(1)|ovary(1)|skin(1)	3				GBM - Glioblastoma multiforme(193;0.0188)		TGAAGACCCCCAGGCAGTGAC	0.572										HNSCC(37;0.09)			8	57	---	---	---	---	capture	Missense_Mutation	SNP	55147969	55147969	LILRB1	19	C	A	A	A	1	0	0	0	0	1	0	0	0	273	21	4	4	8710	240
NLRP7	199713	broad.mit.edu	37	19	55451000	55451000	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr19:55451000C>T	uc002qih.3	-	4	1263	c.1187G>A	c.(1186-1188)CGT>CAT	p.R396H	NLRP7_uc002qig.3_Missense_Mutation_p.R396H|NLRP7_uc002qii.3_Missense_Mutation_p.R396H|NLRP7_uc010esk.2_Missense_Mutation_p.R396H|NLRP7_uc010esl.2_Missense_Mutation_p.R424H	NM_206828	NP_996611	Q8WX94	NALP7_HUMAN	NACHT, leucine rich repeat and PYD containing 7	396	NACHT.						ATP binding			large_intestine(1)|breast(1)|central_nervous_system(1)	3				GBM - Glioblastoma multiforme(193;0.0325)		GCAGAGGAAACGCAGGAACAG	0.706													11	18	---	---	---	---	capture	Missense_Mutation	SNP	55451000	55451000	NLRP7	19	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	10389	240
PUM2	23369	broad.mit.edu	37	2	20482930	20482930	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:20482930G>A	uc002rds.1	-	11	1521	c.1498C>T	c.(1498-1500)CGG>TGG	p.R500W	PUM2_uc002rdt.1_Missense_Mutation_p.R500W|PUM2_uc002rdr.2_Missense_Mutation_p.R439W|PUM2_uc010yjy.1_Missense_Mutation_p.R500W|PUM2_uc002rdu.1_Missense_Mutation_p.R500W|PUM2_uc010yjz.1_Missense_Mutation_p.R439W	NM_015317	NP_056132	Q8TB72	PUM2_HUMAN	pumilio homolog 2	500					regulation of translation	perinuclear region of cytoplasm|stress granule	protein binding|RNA binding			ovary(1)	1	Acute lymphoblastic leukemia(172;0.155)|all_hematologic(175;0.215)					CCAATTGGCCGAAACAGACCA	0.453													4	102	---	---	---	---	capture	Missense_Mutation	SNP	20482930	20482930	PUM2	2	G	A	A	A	1	0	0	0	0	1	0	0	0	480	37	1	1	12721	240
QPCT	25797	broad.mit.edu	37	2	37599531	37599531	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:37599531G>A	uc002rqg.2	+	6	978	c.856G>A	c.(856-858)GAT>AAT	p.D286N	QPCT_uc002rqh.2_Missense_Mutation_p.D237N	NM_012413	NP_036545	Q16769	QPCT_HUMAN	glutaminyl-peptide cyclotransferase precursor	286					peptidyl-pyroglutamic acid biosynthetic process, using glutaminyl-peptide cyclotransferase|proteolysis	extracellular region	acyltransferase activity|glutaminyl-peptide cyclotransferase activity|peptidase activity|zinc ion binding			central_nervous_system(1)	1		Ovarian(717;0.051)|all_hematologic(82;0.21)				TTTGCTCAAGGATCACTCTTT	0.328													63	185	---	---	---	---	capture	Missense_Mutation	SNP	37599531	37599531	QPCT	2	G	A	A	A	1	0	0	0	0	1	0	0	0	533	41	2	2	12769	240
SLC5A7	60482	broad.mit.edu	37	2	108614387	108614387	+	Missense_Mutation	SNP	T	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:108614387T>A	uc002tdv.2	+	5	818	c.542T>A	c.(541-543)CTC>CAC	p.L181H	SLC5A7_uc010ywm.1_5'UTR|SLC5A7_uc010fjj.2_Missense_Mutation_p.L181H|SLC5A7_uc010ywn.1_Missense_Mutation_p.L68H	NM_021815	NP_068587	Q9GZV3	SC5A7_HUMAN	solute carrier family 5 (choline transporter),	181	Helical; (Potential).				acetylcholine biosynthetic process|neurotransmitter secretion	integral to membrane|plasma membrane	choline:sodium symporter activity			ovary(2)|central_nervous_system(1)|skin(1)	4					Choline(DB00122)	GTGGGAGGGCTCTATTCTGTG	0.473													116	174	---	---	---	---	capture	Missense_Mutation	SNP	108614387	108614387	SLC5A7	2	T	A	A	A	1	0	0	0	0	1	0	0	0	702	54	4	4	14562	240
CNTNAP5	129684	broad.mit.edu	37	2	125530385	125530385	+	Missense_Mutation	SNP	A	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:125530385A>G	uc002tno.2	+	17	2904	c.2540A>G	c.(2539-2541)GAG>GGG	p.E847G	CNTNAP5_uc010flu.2_Missense_Mutation_p.E848G	NM_130773	NP_570129	Q8WYK1	CNTP5_HUMAN	contactin associated protein-like 5 precursor	847	Laminin G-like 3.|Extracellular (Potential).				cell adhesion|signal transduction	integral to membrane	receptor binding			ovary(10)	10				BRCA - Breast invasive adenocarcinoma(221;0.248)		GCTCCTTCAGAGATCACCTTT	0.488													28	97	---	---	---	---	capture	Missense_Mutation	SNP	125530385	125530385	CNTNAP5	2	A	G	G	G	1	0	0	0	0	1	0	0	0	143	11	3	3	3615	240
SCN7A	6332	broad.mit.edu	37	2	167273364	167273364	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:167273364G>A	uc002udu.1	-	20	3394	c.3267C>T	c.(3265-3267)GAC>GAT	p.D1089D	SCN7A_uc010fpm.1_RNA	NM_002976	NP_002967	Q01118	SCN7A_HUMAN	sodium channel, voltage-gated, type VII, alpha	1089					muscle contraction	voltage-gated sodium channel complex	voltage-gated sodium channel activity			large_intestine(1)	1						CACTTGTTGGGTCAATGCATT	0.398													19	23	---	---	---	---	capture	Silent	SNP	167273364	167273364	SCN7A	2	G	A	A	A	1	0	0	0	0	0	0	0	1	568	44	2	2	13816	240
TTN	7273	broad.mit.edu	37	2	179453519	179453519	+	Missense_Mutation	SNP	T	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:179453519T>C	uc010zfg.1	-	253	55453	c.55229A>G	c.(55228-55230)GAA>GGA	p.E18410G	uc002umo.2_Intron|uc002ump.1_Intron|TTN_uc010zfh.1_Missense_Mutation_p.E12105G|TTN_uc010zfi.1_Missense_Mutation_p.E12038G|TTN_uc010zfj.1_Missense_Mutation_p.E11913G	NM_133378	NP_596869	Q8WZ42	TITIN_HUMAN	titin isoform N2-A	19337							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			AGTCATCTCTTCTTTGCTTAC	0.438													51	61	---	---	---	---	capture	Missense_Mutation	SNP	179453519	179453519	TTN	2	T	C	C	C	1	0	0	0	0	1	0	0	0	806	62	3	3	16617	240
TTN	7273	broad.mit.edu	37	2	179522849	179522849	+	Missense_Mutation	SNP	T	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:179522849T>A	uc010zfk.1	-	29	2571	c.2023A>T	c.(2023-2025)ATT>TTT	p.I675F	TTN_uc010zfg.1_Intron|TTN_uc010zfh.1_Intron|TTN_uc010zfi.1_Intron|TTN_uc010zfj.1_Intron|TTN_uc002umz.1_Intron|TTN_uc010fre.1_Intron			Q8WZ42	TITIN_HUMAN	SubName: Full=Titin; Flags: Fragment;	Error:AA_residue_mismatch_between_GAF_and_UniProt_prot_seqs_after_alignment							ATP binding|nucleic acid binding|protein serine/threonine kinase activity|protein tyrosine kinase activity			ovary(58)|stomach(19)|large_intestine(17)|lung(16)|skin(16)|breast(10)|pancreas(7)|kidney(4)|central_nervous_system(3)|urinary_tract(2)|upper_aerodigestive_tract(1)	153			OV - Ovarian serous cystadenocarcinoma(117;0.023)|Epithelial(96;0.0454)|all cancers(119;0.134)			GCCACGGGAATTTCTTTTTCT	0.413													30	81	---	---	---	---	capture	Missense_Mutation	SNP	179522849	179522849	TTN	2	T	A	A	A	1	0	0	0	0	1	0	0	0	664	52	4	4	16617	240
STAT1	6772	broad.mit.edu	37	2	191862990	191862990	+	Nonsense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:191862990G>A	uc002usj.2	-	8	974	c.586C>T	c.(586-588)CAG>TAG	p.Q196*	STAT1_uc010fse.1_Nonsense_Mutation_p.Q196*|STAT1_uc002usk.2_Nonsense_Mutation_p.Q196*|STAT1_uc002usl.2_Nonsense_Mutation_p.Q198*|STAT1_uc010fsf.1_Intron	NM_007315	NP_009330	P42224	STAT1_HUMAN	signal transducer and activator of transcription	196					activation of caspase activity|I-kappaB kinase/NF-kappaB cascade|interferon-gamma-mediated signaling pathway|interspecies interaction between organisms|regulation of interferon-gamma-mediated signaling pathway|regulation of type I interferon-mediated signaling pathway|response to virus|type I interferon-mediated signaling pathway|tyrosine phosphorylation of STAT protein	cytosol|nucleolus|nucleoplasm	calcium ion binding|protein binding|RNA polymerase II core promoter sequence-specific DNA binding|RNA polymerase II core promoter sequence-specific DNA binding transcription factor activity|signal transducer activity			lung(3)|breast(3)|central_nervous_system(2)|upper_aerodigestive_tract(1)|ovary(1)	10			OV - Ovarian serous cystadenocarcinoma(117;0.00434)|Epithelial(96;0.0555)|all cancers(119;0.141)		Fludarabine(DB01073)	AGTAACAGCTGTTCTTGTTTC	0.343													5	181	---	---	---	---	capture	Nonsense_Mutation	SNP	191862990	191862990	STAT1	2	G	A	A	A	1	0	0	0	0	0	1	0	0	624	48	5	2	15154	240
STAT4	6775	broad.mit.edu	37	2	191926501	191926501	+	Missense_Mutation	SNP	T	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:191926501T>C	uc002usm.1	-	10	1242	c.988A>G	c.(988-990)AGG>GGG	p.R330G	STAT4_uc002usn.1_Missense_Mutation_p.R330G|STAT4_uc010zgk.1_Missense_Mutation_p.R175G|STAT4_uc002uso.2_Missense_Mutation_p.R330G	NM_003151	NP_003142	Q14765	STAT4_HUMAN	signal transducer and activator of transcription	330					JAK-STAT cascade	cytoplasm|nucleus	calcium ion binding|protein binding|sequence-specific DNA binding transcription factor activity|signal transducer activity			breast(3)|skin(2)|lung(1)|ovary(1)|prostate(1)|pancreas(1)	9			OV - Ovarian serous cystadenocarcinoma(117;0.00854)|Epithelial(96;0.0864)|all cancers(119;0.204)			ACCAACGGCCTCTGAGGGTGG	0.403													6	456	---	---	---	---	capture	Missense_Mutation	SNP	191926501	191926501	STAT4	2	T	C	C	C	1	0	0	0	0	1	0	0	0	700	54	3	3	15157	240
SPHKAP	80309	broad.mit.edu	37	2	228883868	228883868	+	Missense_Mutation	SNP	C	T	T	rs149295795	by1000genomes	TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr2:228883868C>T	uc002vpq.2	-	7	1749	c.1702G>A	c.(1702-1704)GTG>ATG	p.V568M	SPHKAP_uc002vpp.2_Missense_Mutation_p.V568M|SPHKAP_uc010zlx.1_Missense_Mutation_p.V568M	NM_001142644	NP_001136116	Q2M3C7	SPKAP_HUMAN	sphingosine kinase type 1-interacting protein	568						cytoplasm	protein binding			skin(5)|ovary(4)|lung(1)	10		Renal(207;0.025)|all_hematologic(139;0.15)|all_lung(227;0.204)|Acute lymphoblastic leukemia(138;0.205)|Esophageal squamous(248;0.23)		Epithelial(121;8.17e-11)|all cancers(144;7.92e-08)|Lung(261;0.0168)|LUSC - Lung squamous cell carcinoma(224;0.0232)		CAGACAGCCACGGCACTGGCC	0.562													34	160	---	---	---	---	capture	Missense_Mutation	SNP	228883868	228883868	SPHKAP	2	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	14940	240
PHF20	51230	broad.mit.edu	37	20	34526877	34526877	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr20:34526877G>A	uc002xek.1	+	16	2670	c.2559G>A	c.(2557-2559)CAG>CAA	p.Q853Q		NM_016436	NP_057520	Q9BVI0	PHF20_HUMAN	PHD finger protein 20	853					regulation of transcription, DNA-dependent|transcription, DNA-dependent	MLL1 complex	DNA binding|zinc ion binding			ovary(1)	1	Breast(12;0.00631)|all_lung(11;0.0145)					CCGTGGAGCAGAAGCTGGTGG	0.647													20	63	---	---	---	---	capture	Silent	SNP	34526877	34526877	PHF20	20	G	A	A	A	1	0	0	0	0	0	0	0	1	425	33	2	2	11734	240
SEMG1	6406	broad.mit.edu	37	20	43836560	43836560	+	Missense_Mutation	SNP	C	T	T	rs141417035	by1000genomes	TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr20:43836560C>T	uc002xni.2	+	2	679	c.622C>T	c.(622-624)CGT>TGT	p.R208C	SEMG1_uc002xnj.2_Missense_Mutation_p.R208C|SEMG2_uc010ggz.2_Intron|SEMG1_uc002xnh.2_Missense_Mutation_p.R208C	NM_003007	NP_002998	P04279	SEMG1_HUMAN	semenogelin I preproprotein	208	42 AA repeat 1.				insemination|sexual reproduction	extracellular space|stored secretory granule	structural molecule activity			skin(2)	2		Myeloproliferative disorder(115;0.0122)				CAAACAACAACGTGAGACTAA	0.403													38	67	---	---	---	---	capture	Missense_Mutation	SNP	43836560	43836560	SEMG1	20	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	13937	240
ADAMTS1	9510	broad.mit.edu	37	21	28217207	28217207	+	Silent	SNP	G	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr21:28217207G>T	uc002ymf.2	-	1	522	c.67C>A	c.(67-69)CGG>AGG	p.R23R		NM_006988	NP_008919	Q9UHI8	ATS1_HUMAN	ADAM metallopeptidase with thrombospondin type 1	23					integrin-mediated signaling pathway|negative regulation of cell proliferation|proteolysis		heparin binding|zinc ion binding			lung(3)|large_intestine(2)|central_nervous_system(1)	6		Breast(209;0.000962)		Lung(58;0.215)		CCCGGAGCCCGCTCCGCGTTC	0.711											OREG0026151	type=REGULATORY REGION|TFbs=CTCF|Dataset=CTCF ChIP-chip sites (Ren lab)|EvidenceSubtype=ChIP-on-chip (ChIP-chip)	12	15	---	---	---	---	capture	Silent	SNP	28217207	28217207	ADAMTS1	21	G	T	T	T	1	0	0	0	0	0	0	0	1	493	38	4	4	255	240
RNF160	26046	broad.mit.edu	37	21	30359239	30359239	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr21:30359239C>T	uc002ymr.2	-	2	210	c.197G>A	c.(196-198)CGA>CAA	p.R66Q	RNF160_uc010gll.1_RNA	NM_015565	NP_056380	O94822	LTN1_HUMAN	zinc finger protein 294	20							ligase activity|zinc ion binding				0						TTCTGCAGCTCGGCCACTGTT	0.433													12	91	---	---	---	---	capture	Missense_Mutation	SNP	30359239	30359239	RNF160	21	C	T	T	T	1	0	0	0	0	1	0	0	0	403	31	1	1	13347	240
NHP2L1	4809	broad.mit.edu	37	22	42071074	42071074	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr22:42071074G>A	uc003bat.2	-	3	444	c.250C>T	c.(250-252)CGC>TGC	p.R84C	NHP2L1_uc003bau.2_Missense_Mutation_p.R84C|NHP2L1_uc003bav.2_Missense_Mutation_p.R84C|NHP2L1_uc003baw.2_Missense_Mutation_p.R84C	NM_005008	NP_004999	P55769	NH2L1_HUMAN	NHP2 non-histone chromosome protein 2-like 1	84					nuclear mRNA splicing, via spliceosome|ribosome biogenesis	box C/D snoRNP complex|nucleoplasm|spliceosomal complex	protein binding|RNA binding				0						TGCTTGGAGCGCACAAACACG	0.577													4	102	---	---	---	---	capture	Missense_Mutation	SNP	42071074	42071074	NHP2L1	22	G	A	A	A	1	0	0	0	0	1	0	0	0	494	38	1	1	10317	240
EFCAB6	64800	broad.mit.edu	37	22	43933388	43933388	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr22:43933388G>A	uc003bdy.1	-	29	4132	c.3917C>T	c.(3916-3918)CCC>CTC	p.P1306L	EFCAB6_uc003bdz.1_Missense_Mutation_p.P1154L|EFCAB6_uc010gzi.1_Missense_Mutation_p.P1154L	NM_022785	NP_073622	Q5THR3	EFCB6_HUMAN	CAP-binding protein complex interacting protein	1306	Interaction with PARK7.				regulation of transcription, DNA-dependent|transcription, DNA-dependent	nucleus	calcium ion binding			ovary(3)|skin(2)|upper_aerodigestive_tract(1)|pancreas(1)	7		Ovarian(80;0.0247)|all_neural(38;0.025)				GTTCTGCAAGGGTGGAGTGCC	0.517													33	71	---	---	---	---	capture	Missense_Mutation	SNP	43933388	43933388	EFCAB6	22	G	A	A	A	1	0	0	0	0	1	0	0	0	559	43	2	2	4894	240
C3orf45	132228	broad.mit.edu	37	3	50324238	50324238	+	Silent	SNP	C	T	T	rs116862338	by1000genomes	TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:50324238C>T	uc003cyz.2	+	3	333	c.306C>T	c.(304-306)CTC>CTT	p.L102L		NM_153215	NP_694947	Q8N112	CC045_HUMAN	hypothetical protein LOC132228	102	Helical; (Potential).					integral to membrane				ovary(1)	1				BRCA - Breast invasive adenocarcinoma(193;0.000272)|KIRC - Kidney renal clear cell carcinoma(197;0.00544)|Kidney(197;0.00607)		TGCTGCTGCTCGCGCTGCTGG	0.617													19	38	---	---	---	---	capture	Silent	SNP	50324238	50324238	C3orf45	3	C	T	T	T	1	0	0	0	0	0	0	0	1	392	31	1	1	2211	240
STAB1	23166	broad.mit.edu	37	3	52540843	52540843	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:52540843G>A	uc003dej.2	+	18	2040	c.1966G>A	c.(1966-1968)GAG>AAG	p.E656K	STAB1_uc003dei.1_Missense_Mutation_p.E656K	NM_015136	NP_055951	Q9NY15	STAB1_HUMAN	stabilin 1 precursor	656	Extracellular (Potential).				cell adhesion|cell-cell signaling|defense response to bacterium|inflammatory response|negative regulation of angiogenesis|receptor-mediated endocytosis	integral to plasma membrane	bacterial cell surface binding|hyaluronic acid binding|low-density lipoprotein receptor activity|protein disulfide oxidoreductase activity|scavenger receptor activity			large_intestine(3)|upper_aerodigestive_tract(2)|central_nervous_system(1)|breast(1)|skin(1)|pancreas(1)	9				BRCA - Breast invasive adenocarcinoma(193;1.73e-05)|Kidney(197;0.00182)|KIRC - Kidney renal clear cell carcinoma(197;0.00205)|OV - Ovarian serous cystadenocarcinoma(275;0.0482)		GCACTGCAGCGAGGAGCAGCA	0.642													25	54	---	---	---	---	capture	Missense_Mutation	SNP	52540843	52540843	STAB1	3	G	A	A	A	1	0	0	0	0	1	0	0	0	481	37	1	1	15127	240
C3orf67	200844	broad.mit.edu	37	3	58856003	58856003	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:58856003G>A	uc003dkt.1	-	8	782	c.373C>T	c.(373-375)CGG>TGG	p.R125W	C3orf67_uc003dks.1_5'Flank|uc003dku.1_Intron|C3orf67_uc003dkv.1_Translation_Start_Site|C3orf67_uc003dkw.2_Missense_Mutation_p.R33W	NM_198463	NP_940865	Q6ZVT6	CC067_HUMAN	hypothetical protein LOC200844	125											0		all_cancers(2;0.000156)|all_epithelial(2;0.000493)|Breast(2;0.00446)|all_lung(2;0.074)|Lung NSC(2;0.248)		BRCA - Breast invasive adenocarcinoma(55;5.93e-06)|Kidney(10;0.00155)|KIRC - Kidney renal clear cell carcinoma(10;0.00172)|OV - Ovarian serous cystadenocarcinoma(275;0.23)		TTACTGTTCCGTGTAATACTT	0.378													15	125	---	---	---	---	capture	Missense_Mutation	SNP	58856003	58856003	C3orf67	3	G	A	A	A	1	0	0	0	0	1	0	0	0	519	40	1	1	2221	240
KIAA1524	57650	broad.mit.edu	37	3	108279495	108279495	+	Splice_Site	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:108279495C>T	uc003dxb.3	-	14	2096	c.1827_splice	c.e14+1	p.V609_splice		NM_020890	NP_065941	Q8TCG1	CIP2A_HUMAN	p90 autoantigen							cytoplasm|integral to membrane	protein binding			ovary(2)|central_nervous_system(1)	3						TTTTCACTCACCACCATTCCA	0.328													73	174	---	---	---	---	capture	Splice_Site	SNP	108279495	108279495	KIAA1524	3	C	T	T	T	1	0	0	0	0	0	0	1	0	234	18	5	2	8161	240
PRR23C	389152	broad.mit.edu	37	3	138762829	138762829	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:138762829G>A	uc011bmt.1	-	1	906	c.634C>T	c.(634-636)CGC>TGC	p.R212C		NM_001134657	NP_001128129	Q6ZRP0	PR23C_HUMAN	proline rich 23C	212	Pro-rich.									skin(1)	1						AAGATGGGGCGTGGAGAGCGT	0.647													7	14	---	---	---	---	capture	Missense_Mutation	SNP	138762829	138762829	PRR23C	3	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	12491	240
LEKR1	389170	broad.mit.edu	37	3	156763371	156763371	+	Silent	SNP	C	T	T	rs144318565		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:156763371C>T	uc003fba.1	+	14	2334	c.999C>T	c.(997-999)CGC>CGT	p.R333R		NM_001004316	NP_001004316	Q6ZMV7	LEKR1_HUMAN	leucine, glutamate and lysine rich 1	Error:Variant_position_missing_in_D3DNK7_after_alignment											0			LUSC - Lung squamous cell carcinoma(72;0.0461)|Lung(72;0.0465)			CCAACCTGCGCGGGGTGTCAA	0.552													57	116	---	---	---	---	capture	Silent	SNP	156763371	156763371	LEKR1	3	C	T	T	T	1	0	0	0	0	0	0	0	1	340	27	1	1	8637	240
C4orf23	152992	broad.mit.edu	37	4	8472818	8472818	+	Silent	SNP	A	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:8472818A>G	uc003glg.1	+	10	1436	c.1248A>G	c.(1246-1248)CTA>CTG	p.L416L	C4orf23_uc003glh.1_Silent_p.L253L|C4orf23_uc003gli.1_5'Flank	NM_152544	NP_689757	Q8IYL2	TRM44_HUMAN	hypothetical protein LOC152992 isoform 2	645					tRNA processing	cytoplasm	methyltransferase activity|nucleic acid binding|zinc ion binding				0						CAGAGAGCCTATCTCTGGCAG	0.532													100	202	---	---	---	---	capture	Silent	SNP	8472818	8472818	C4orf23	4	A	G	G	G	1	0	0	0	0	0	0	0	1	197	16	3	3	2234	240
GPR78	27201	broad.mit.edu	37	4	8588808	8588808	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:8588808C>T	uc003glk.2	+	3	1229	c.810C>T	c.(808-810)ACC>ACT	p.T270T	CPZ_uc003gll.2_Intron	NM_080819	NP_543009	Q96P69	GPR78_HUMAN	G protein-coupled receptor 78	270	Extracellular (Potential).				activation of adenylate cyclase activity by G-protein signaling pathway	integral to membrane|plasma membrane	G-protein coupled receptor activity			central_nervous_system(4)|ovary(2)	6						CCTTCGTCACCGTGAACGCCC	0.662													3	41	---	---	---	---	capture	Silent	SNP	8588808	8588808	GPR78	4	C	T	T	T	1	0	0	0	0	0	0	0	1	288	23	1	1	6643	240
CENPE	1062	broad.mit.edu	37	4	104044141	104044141	+	Missense_Mutation	SNP	T	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:104044141T>C	uc003hxb.1	-	43	7120	c.7030A>G	c.(7030-7032)AAA>GAA	p.K2344E	CENPE_uc003hxc.1_Missense_Mutation_p.K2223E	NM_001813	NP_001804	Q02224	CENPE_HUMAN	centromere protein E	2344	Kinetochore-binding domain.|Potential.				blood coagulation|cell division|kinetochore assembly|microtubule-based movement|mitotic chromosome movement towards spindle pole|mitotic metaphase|mitotic metaphase plate congression|mitotic prometaphase|multicellular organismal development|positive regulation of protein kinase activity	condensed chromosome kinetochore|cytosol|microtubule|nucleus|spindle	ATP binding|kinetochore binding|microtubule motor activity			ovary(5)|breast(4)	9				OV - Ovarian serous cystadenocarcinoma(123;2.95e-08)		TGGTAGTTTTTAAATAGTTTT	0.378													57	129	---	---	---	---	capture	Missense_Mutation	SNP	104044141	104044141	CENPE	4	T	C	C	C	1	0	0	0	0	1	0	0	0	793	61	3	3	3198	240
ING2	3622	broad.mit.edu	37	4	184431464	184431464	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr4:184431464G>A	uc003ivs.1	+	2	331	c.202G>A	c.(202-204)GAA>AAA	p.E68K	ING2_uc011ckk.1_Missense_Mutation_p.E28K	NM_001564	NP_001555	Q9H160	ING2_HUMAN	inhibitor of growth family, member 2	68	Potential.				chromatin modification|positive regulation of transcription, DNA-dependent|positive regulation of transforming growth factor beta receptor signaling pathway|regulation of growth|signal transduction|transcription, DNA-dependent	CCAAT-binding factor complex|Sin3 complex	chromatin binding|DNA binding|protein complex binding|zinc ion binding			ovary(1)	1		all_lung(41;5.16e-14)|Lung NSC(41;1.33e-13)|Colorectal(36;0.00139)|Hepatocellular(41;0.00886)|Renal(120;0.00988)|all_hematologic(60;0.0207)|Prostate(90;0.0235)|all_neural(102;0.202)		all cancers(43;1.15e-26)|Epithelial(43;2.98e-22)|OV - Ovarian serous cystadenocarcinoma(60;7.64e-10)|GBM - Glioblastoma multiforme(59;4.22e-06)|Colorectal(24;5.87e-06)|STAD - Stomach adenocarcinoma(60;2.09e-05)|COAD - Colon adenocarcinoma(29;5.15e-05)|LUSC - Lung squamous cell carcinoma(40;0.00902)|READ - Rectum adenocarcinoma(43;0.155)		TGATGTCTACGAAAAATATAA	0.318													53	112	---	---	---	---	capture	Missense_Mutation	SNP	184431464	184431464	ING2	4	G	A	A	A	1	0	0	0	0	1	0	0	0	481	37	1	1	7659	240
SLC6A18	348932	broad.mit.edu	37	5	1244741	1244741	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:1244741G>A	uc003jby.1	+	11	1638	c.1515G>A	c.(1513-1515)GCG>GCA	p.A505A		NM_182632	NP_872438	Q96N87	S6A18_HUMAN	solute carrier family 6, member 18	505	Cytoplasmic (Potential).				cellular nitrogen compound metabolic process	integral to plasma membrane	amino acid transmembrane transporter activity|neurotransmitter:sodium symporter activity			ovary(1)	1	all_cancers(3;2.99e-16)|Lung NSC(6;8.55e-15)|all_lung(6;7.2e-14)|all_epithelial(6;1.76e-10)		Epithelial(17;0.000356)|all cancers(22;0.00124)|OV - Ovarian serous cystadenocarcinoma(19;0.00239)|Lung(60;0.185)			ATGACATTGCGTGGATGACCG	0.612													24	65	---	---	---	---	capture	Silent	SNP	1244741	1244741	SLC6A18	5	G	A	A	A	1	0	0	0	0	0	0	0	1	509	40	1	1	14573	240
BASP1	10409	broad.mit.edu	37	5	17275800	17275800	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:17275800G>A	uc003jfx.2	+	2	654	c.475G>A	c.(475-477)GCC>ACC	p.A159T		NM_006317	NP_006308	P80723	BASP1_HUMAN	brain abundant, membrane attached signal protein	159					glomerular visceral epithelial cell differentiation|negative regulation of transcription, DNA-dependent	cytoplasm|cytoskeleton|growth cone|nuclear speck|plasma membrane	protein domain specific binding|transcription corepressor activity|transcription regulatory region DNA binding				0						AGCTCCTGCCGCCCAGGAGAC	0.522													7	5	---	---	---	---	capture	Missense_Mutation	SNP	17275800	17275800	BASP1	5	G	A	A	A	1	0	0	0	0	1	0	0	0	494	38	1	1	1306	240
DDX4	54514	broad.mit.edu	37	5	55083676	55083676	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:55083676G>A	uc003jqg.3	+	15	1094	c.1020G>A	c.(1018-1020)GCG>GCA	p.A340A	DDX4_uc010ivz.2_Silent_p.A320A|DDX4_uc003jqh.3_Silent_p.A306A|DDX4_uc003jqj.2_Silent_p.A191A	NM_001136034	NP_001129506	Q9NQI0	DDX4_HUMAN	DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 isoform	340	Helicase ATP-binding.				multicellular organismal development|sperm motility	perinuclear region of cytoplasm|pi-body|piP-body	ATP binding|ATP-dependent helicase activity|nucleic acid binding			ovary(1)|skin(1)	2		Lung NSC(810;6.93e-05)|all_neural(839;0.00409)|Prostate(74;0.0107)|Breast(144;0.0544)|Ovarian(174;0.223)				ACTTCTAGGCGGCTTTTCTCC	0.383													53	141	---	---	---	---	capture	Silent	SNP	55083676	55083676	DDX4	5	G	A	A	A	1	0	0	0	0	0	0	0	1	496	39	1	1	4318	240
DMGDH	29958	broad.mit.edu	37	5	78340364	78340364	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:78340364G>A	uc003kfs.2	-	6	763	c.757C>T	c.(757-759)CGT>TGT	p.R253C	DMGDH_uc011cte.1_Missense_Mutation_p.R103C|DMGDH_uc011ctf.1_Missense_Mutation_p.R52C|DMGDH_uc011ctg.1_Intron	NM_013391	NP_037523	Q9UI17	M2GD_HUMAN	dimethylglycine dehydrogenase precursor	253					choline metabolic process|glycine catabolic process	mitochondrial matrix	aminomethyltransferase activity|dimethylglycine dehydrogenase activity|electron carrier activity			ovary(2)|liver(1)|skin(1)	4		all_lung(232;0.000638)|Lung NSC(167;0.00173)|Ovarian(174;0.0262)|Prostate(461;0.192)		OV - Ovarian serous cystadenocarcinoma(54;6.52e-45)|Epithelial(54;5.96e-40)|all cancers(79;3.56e-35)		CCTACTTCACGAGCCCAAAAT	0.318													4	86	---	---	---	---	capture	Missense_Mutation	SNP	78340364	78340364	DMGDH	5	G	A	A	A	1	0	0	0	0	1	0	0	0	481	37	1	1	4539	240
FAM81B	153643	broad.mit.edu	37	5	94749817	94749817	+	Missense_Mutation	SNP	T	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:94749817T>A	uc003kla.1	+	4	506	c.460T>A	c.(460-462)TCG>ACG	p.S154T	FAM81B_uc010jbe.1_5'UTR	NM_152548	NP_689761	Q96LP2	FA81B_HUMAN	hypothetical protein LOC153643	154										ovary(1)|skin(1)	2		all_cancers(142;1.1e-06)|all_epithelial(76;1.48e-09)|all_lung(232;0.000696)|Lung NSC(167;0.000947)|Ovarian(225;0.00473)		all cancers(79;1.04e-16)		AAAAGAGGAATCGCTCGCCAG	0.478													42	97	---	---	---	---	capture	Missense_Mutation	SNP	94749817	94749817	FAM81B	5	T	A	A	A	1	0	0	0	0	1	0	0	0	650	50	4	4	5575	240
RAPGEF6	51735	broad.mit.edu	37	5	130940379	130940379	+	Missense_Mutation	SNP	T	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:130940379T>A	uc003kvn.1	-	2	283	c.77A>T	c.(76-78)AAT>ATT	p.N26I	RAPGEF6_uc003kvp.1_Missense_Mutation_p.N76I|RAPGEF6_uc003kvo.1_Missense_Mutation_p.N26I|RAPGEF6_uc010jdi.1_Missense_Mutation_p.N26I|RAPGEF6_uc010jdj.1_Missense_Mutation_p.N26I|RAPGEF6_uc003kvr.2_Missense_Mutation_p.N26I|RAPGEF6_uc011cxe.1_RNA|RAPGEF6_uc010jdk.2_Missense_Mutation_p.N26I	NM_016340	NP_057424	Q8TEU7	RPGF6_HUMAN	PDZ domain-containing guanine nucleotide	26					Ras protein signal transduction|regulation of GTPase activity|regulation of small GTPase mediated signal transduction	cytoplasm|plasma membrane	GTP-dependent protein binding|guanyl-nucleotide exchange factor activity|Ras GTPase binding			ovary(1)|lung(1)|central_nervous_system(1)	3			KIRC - Kidney renal clear cell carcinoma(527;0.0186)|Kidney(363;0.0365)	Lung(113;0.0721)		ATAAATAGTATTTAAGTCCTG	0.318													10	66	---	---	---	---	capture	Missense_Mutation	SNP	130940379	130940379	RAPGEF6	5	T	A	A	A	1	0	0	0	0	1	0	0	0	676	52	4	4	12943	240
FBXO38	81545	broad.mit.edu	37	5	147796556	147796556	+	Splice_Site	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:147796556G>C	uc003lpf.1	+	12	1528	c.1408_splice	c.e12-1	p.G470_splice	FBXO38_uc003lpg.1_Splice_Site_p.G470_splice|FBXO38_uc003lph.2_Splice_Site_p.G470_splice	NM_205836	NP_995308	Q6PIJ6	FBX38_HUMAN	F-box protein 38 isoform b							cytoplasm|nucleus				ovary(4)|skin(2)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			TTTTGCCTTAGGGTTGTGCTC	0.363													10	79	---	---	---	---	capture	Splice_Site	SNP	147796556	147796556	FBXO38	5	G	C	C	C	1	0	0	0	0	0	0	1	0	455	35	5	4	5692	240
FBXO38	81545	broad.mit.edu	37	5	147796638	147796638	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:147796638G>C	uc003lpf.1	+	12	1609	c.1489G>C	c.(1489-1491)GAC>CAC	p.D497H	FBXO38_uc003lpg.1_Missense_Mutation_p.D497H|FBXO38_uc003lph.2_Missense_Mutation_p.D497H	NM_205836	NP_995308	Q6PIJ6	FBX38_HUMAN	F-box protein 38 isoform b	497						cytoplasm|nucleus				ovary(4)|skin(2)	6			KIRC - Kidney renal clear cell carcinoma(527;0.00112)|Kidney(363;0.00191)			CTCCAACAATGACGATAATAA	0.453													8	78	---	---	---	---	capture	Missense_Mutation	SNP	147796638	147796638	FBXO38	5	G	C	C	C	1	0	0	0	0	1	0	0	0	585	45	4	4	5692	240
NIPAL4	348938	broad.mit.edu	37	5	156890242	156890242	+	Missense_Mutation	SNP	C	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:156890242C>G	uc003lwx.3	+	2	480	c.364C>G	c.(364-366)CTG>GTG	p.L122V	ADAM19_uc003lww.1_Intron|NIPAL4_uc011ddq.1_Missense_Mutation_p.L122V|NIPAL4_uc010jin.1_Silent_p.A56A	NM_001099287	NP_001092757	Q0D2K0	NIPA4_HUMAN	ichthyin protein	122	Helical; (Potential).					integral to membrane	receptor activity				0						CTACATCGGCCTGGGCCTGGC	0.577													22	61	---	---	---	---	capture	Missense_Mutation	SNP	156890242	156890242	NIPAL4	5	C	G	G	G	1	0	0	0	0	1	0	0	0	311	24	4	4	10334	240
GABRA1	2554	broad.mit.edu	37	5	161324318	161324318	+	Nonsense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr5:161324318C>T	uc010jiw.2	+	11	1729	c.1261C>T	c.(1261-1263)CGA>TGA	p.R421*	GABRA1_uc010jix.2_Nonsense_Mutation_p.R421*|GABRA1_uc010jiy.2_Nonsense_Mutation_p.R421*|GABRA1_uc003lyx.3_Nonsense_Mutation_p.R421*|GABRA1_uc010jiz.2_Nonsense_Mutation_p.R421*|GABRA1_uc010jja.2_Nonsense_Mutation_p.R421*|GABRA1_uc010jjb.2_Nonsense_Mutation_p.R421*	NM_000806	NP_000797	P14867	GBRA1_HUMAN	gamma-aminobutyric acid (GABA) A receptor, alpha	421	Cytoplasmic (Probable).				gamma-aminobutyric acid signaling pathway|synaptic transmission	cell junction|chloride channel complex|integral to plasma membrane|postsynaptic membrane	chloride channel activity|extracellular ligand-gated ion channel activity|GABA-A receptor activity			ovary(2)|pancreas(1)	3	Renal(175;0.00259)	Medulloblastoma(196;0.0208)|all_neural(177;0.0672)	Kidney(164;7.83e-05)|KIRC - Kidney renal clear cell carcinoma(164;0.000525)	all cancers(165;0.228)	Alprazolam(DB00404)|Butabarbital(DB00237)|Butalbital(DB00241)|Butethal(DB01353)|Chlordiazepoxide(DB00475)|Clobazam(DB00349)|Clonazepam(DB01068)|Clorazepate(DB00628)|Desflurane(DB01189)|Diazepam(DB00829)|Enflurane(DB00228)|Ethanol(DB00898)|Ethchlorvynol(DB00189)|Etomidate(DB00292)|Flumazenil(DB01205)|Flurazepam(DB00690)|Halazepam(DB00801)|Halothane(DB01159)|Hexobarbital(DB01355)|Isoflurane(DB00753)|Lorazepam(DB00186)|Meprobamate(DB00371)|Metharbital(DB00463)|Methohexital(DB00474)|Methoxyflurane(DB01028)|Methylphenobarbital(DB00849)|Methyprylon(DB01107)|Midazolam(DB00683)|Nitrazepam(DB01595)|Oxazepam(DB00842)|Pentobarbital(DB00312)|Phenobarbital(DB01174)|Picrotoxin(DB00466)|Prazepam(DB01588)|Primidone(DB00794)|Progabide(DB00837)|Propofol(DB00818)|Quazepam(DB01589)|Secobarbital(DB00418)|Sevoflurane(DB01236)|Talbutal(DB00306)|Thiamylal(DB01154)|Thiopental(DB00599)|Topiramate(DB00273)|Zaleplon(DB00962)|Zolpidem(DB00425)	CAAAATTGACCGACTGTCAAG	0.443													107	165	---	---	---	---	capture	Nonsense_Mutation	SNP	161324318	161324318	GABRA1	5	C	T	T	T	1	0	0	0	0	0	1	0	0	295	23	5	1	6102	240
MCHR2	84539	broad.mit.edu	37	6	100382322	100382322	+	Missense_Mutation	SNP	A	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr6:100382322A>G	uc003pqh.1	-	5	974	c.659T>C	c.(658-660)ATT>ACT	p.I220T	MCHR2_uc003pqi.1_Missense_Mutation_p.I220T	NM_001040179	NP_001035269	Q969V1	MCHR2_HUMAN	melanin-concentrating hormone receptor 2	220	Helical; Name=5; (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(3)|ovary(2)|breast(1)|central_nervous_system(1)|skin(1)	8		all_cancers(76;4.87e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0309)|Colorectal(196;0.069)		BRCA - Breast invasive adenocarcinoma(108;0.0429)		ATAGCATAAAATTAAAATATA	0.279													4	201	---	---	---	---	capture	Missense_Mutation	SNP	100382322	100382322	MCHR2	6	A	G	G	G	1	0	0	0	0	1	0	0	0	52	4	3	3	9296	240
MCHR2	84539	broad.mit.edu	37	6	100395726	100395726	+	Missense_Mutation	SNP	C	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr6:100395726C>A	uc003pqh.1	-	3	619	c.304G>T	c.(304-306)GGG>TGG	p.G102W	MCHR2_uc003pqi.1_Missense_Mutation_p.G102W	NM_001040179	NP_001035269	Q969V1	MCHR2_HUMAN	melanin-concentrating hormone receptor 2	102	Extracellular (Potential).					integral to membrane|plasma membrane	G-protein coupled receptor activity			lung(3)|ovary(2)|breast(1)|central_nervous_system(1)|skin(1)	8		all_cancers(76;4.87e-05)|Acute lymphoblastic leukemia(125;4.99e-11)|all_hematologic(75;5.82e-08)|all_epithelial(107;0.0309)|Colorectal(196;0.069)		BRCA - Breast invasive adenocarcinoma(108;0.0429)		AGAGGCCCCCCAAACACCCAC	0.488													68	166	---	---	---	---	capture	Missense_Mutation	SNP	100395726	100395726	MCHR2	6	C	A	A	A	1	0	0	0	0	1	0	0	0	273	21	4	4	9296	240
HDAC2	3066	broad.mit.edu	37	6	114265495	114265495	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr6:114265495G>C	uc003pwd.1	-	11	1453	c.1453C>G	c.(1453-1455)CAT>GAT	p.H485D	HDAC2_uc003pwc.1_Missense_Mutation_p.H361D|HDAC2_uc003pwe.1_Missense_Mutation_p.H361D	NM_001527	NP_001518	Q92769	HDAC2_HUMAN	histone deacetylase 2	391					blood coagulation|dendrite development|embryonic digit morphogenesis|epidermal cell differentiation|eyelid development in camera-type eye|fungiform papilla formation|hair follicle placode formation|maintenance of chromatin silencing|negative regulation of apoptosis|negative regulation of cell cycle|negative regulation of neuron projection development|negative regulation of sequence-specific DNA binding transcription factor activity|negative regulation of transcription from RNA polymerase II promoter|nerve growth factor receptor signaling pathway|odontogenesis of dentine-containing tooth|positive regulation of cell proliferation|positive regulation of proteolysis|positive regulation of receptor biosynthetic process|positive regulation of transcription from RNA polymerase II promoter	cytoplasm|ESC/E(Z) complex|NuRD complex|Sin3 complex	chromatin binding|enzyme binding|histone deacetylase activity (H3-K16 specific)|NAD-dependent histone deacetylase activity (H3-K14 specific)|NAD-dependent histone deacetylase activity (H3-K9 specific)|NAD-dependent histone deacetylase activity (H4-K16 specific)|sequence-specific DNA binding|transcription factor binding			skin(2)|ovary(1)|central_nervous_system(1)	4		all_cancers(87;0.000629)|all_epithelial(87;0.00274)|Colorectal(196;0.0317)|all_lung(197;0.24)		all cancers(137;0.00318)|OV - Ovarian serous cystadenocarcinoma(136;0.00569)|Epithelial(106;0.0112)|GBM - Glioblastoma multiforme(226;0.0832)	Vorinostat(DB02546)	CTGTCTTCATGAACAGCATCT	0.363													50	69	---	---	---	---	capture	Missense_Mutation	SNP	114265495	114265495	HDAC2	6	G	C	C	C	1	0	0	0	0	1	0	0	0	585	45	4	4	6934	240
MAP7	9053	broad.mit.edu	37	6	136682257	136682257	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr6:136682257C>T	uc003qgz.2	-	12	1833	c.1587G>A	c.(1585-1587)GAG>GAA	p.E529E	MAP7_uc011edf.1_Silent_p.E514E|MAP7_uc011edg.1_Silent_p.E559E|MAP7_uc010kgu.2_Silent_p.E551E|MAP7_uc011edh.1_Silent_p.E514E|MAP7_uc010kgv.2_Silent_p.E551E|MAP7_uc010kgs.2_Silent_p.E383E|MAP7_uc011edi.1_Silent_p.E383E|MAP7_uc010kgq.1_Silent_p.E435E|MAP7_uc003qha.1_Silent_p.E492E	NM_003980	NP_003971	Q14244	MAP7_HUMAN	microtubule-associated protein 7	529	Potential.				establishment or maintenance of cell polarity|microtubule cytoskeleton organization|protein localization in plasma membrane|response to osmotic stress	basolateral plasma membrane|microtubule|microtubule associated complex|nucleus|perinuclear region of cytoplasm	receptor binding|structural molecule activity				0	Colorectal(23;0.24)			GBM - Glioblastoma multiforme(68;0.00199)|OV - Ovarian serous cystadenocarcinoma(155;0.00643)		TGCGCGACTCCTCCTCACGGC	0.617													6	41	---	---	---	---	capture	Silent	SNP	136682257	136682257	MAP7	6	C	T	T	T	1	0	0	0	0	0	0	0	1	311	24	2	2	9179	240
KIAA0415	9907	broad.mit.edu	37	7	4820908	4820908	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:4820908C>T	uc003sne.2	+	2	227	c.144C>T	c.(142-144)CTC>CTT	p.L48L	KIAA0415_uc010ksp.2_RNA	NM_014855	NP_055670	O43299	K0415_HUMAN	hypothetical protein LOC9907	48					cell death|double-strand break repair via homologous recombination	cytoplasm|nucleus	protein binding			central_nervous_system(1)	1		Ovarian(82;0.0175)		UCEC - Uterine corpus endometrioid carcinoma (126;0.091)|OV - Ovarian serous cystadenocarcinoma(56;8.35e-15)		TGCAGAGGCTCTTCCTCATCA	0.632													24	78	---	---	---	---	capture	Silent	SNP	4820908	4820908	KIAA0415	7	C	T	T	T	1	0	0	0	0	0	0	0	1	405	32	2	2	8097	240
ABCB5	340273	broad.mit.edu	37	7	20744386	20744386	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:20744386G>A	uc003suw.3	+	11	1588	c.1042G>A	c.(1042-1044)GGC>AGC	p.G348S	ABCB5_uc010kuh.2_Missense_Mutation_p.G793S	NM_178559	NP_848654	Q2M3G0	ABCB5_HUMAN	ATP-binding cassette, sub-family B, member 5	348	Extracellular (Potential).|ABC transmembrane type-1.				regulation of membrane potential	apical plasma membrane|Golgi membrane|integral to plasma membrane|intercellular canaliculus	ATP binding|ATPase activity, coupled to transmembrane movement of substances|efflux transmembrane transporter activity			skin(2)|large_intestine(1)|haematopoietic_and_lymphoid_tissue(1)|ovary(1)|pancreas(1)	6						CAGCACAGGAGGCTTGACAAC	0.328													27	93	---	---	---	---	capture	Missense_Mutation	SNP	20744386	20744386	ABCB5	7	G	A	A	A	1	0	0	0	0	1	0	0	0	455	35	2	2	44	240
CHN2	1124	broad.mit.edu	37	7	29539600	29539600	+	Missense_Mutation	SNP	A	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:29539600A>C	uc003szz.2	+	9	1294	c.857A>C	c.(856-858)CAC>CCC	p.H286P	CHN2_uc011jzs.1_Missense_Mutation_p.H361P|CHN2_uc010kva.2_Missense_Mutation_p.H56P|CHN2_uc010kvb.2_Intron|CHN2_uc010kvc.2_Missense_Mutation_p.H251P|CHN2_uc011jzt.1_Missense_Mutation_p.H299P|CHN2_uc010kvd.2_Missense_Mutation_p.H142P|CHN2_uc011jzu.1_Missense_Mutation_p.H271P|CHN2_uc010kvg.2_Missense_Mutation_p.H150P|CHN2_uc010kvh.2_Intron|CHN2_uc010kvi.2_Missense_Mutation_p.H150P|CHN2_uc010kve.2_Missense_Mutation_p.H150P|CHN2_uc003taa.2_Missense_Mutation_p.H150P|CHN2_uc010kvf.2_Intron|CHN2_uc010kvj.2_Missense_Mutation_p.H105P|CHN2_uc010kvk.2_Intron|CHN2_uc010kvl.2_RNA|CHN2_uc010kvm.2_Missense_Mutation_p.H105P|CHN2_uc011jzv.1_Missense_Mutation_p.H79P	NM_004067	NP_004058	P52757	CHIO_HUMAN	beta chimerin isoform 2	286	Rho-GAP.				regulation of small GTPase mediated signal transduction|small GTPase mediated signal transduction	cytosol|membrane	GTPase activator activity|metal ion binding|SH3/SH2 adaptor activity			ovary(2)	2						GTGAAGGCTCACAACACTCAG	0.413													24	71	---	---	---	---	capture	Missense_Mutation	SNP	29539600	29539600	CHN2	7	A	C	C	C	1	0	0	0	0	1	0	0	0	78	6	4	4	3328	240
CCDC129	223075	broad.mit.edu	37	7	31682400	31682400	+	Silent	SNP	G	A	A	rs146986060		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:31682400G>A	uc003tcj.1	+	11	2409	c.1416G>A	c.(1414-1416)TCG>TCA	p.S472S	CCDC129_uc011kad.1_Silent_p.S482S|CCDC129_uc003tci.1_Silent_p.S323S|CCDC129_uc011kae.1_Silent_p.S498S|CCDC129_uc003tck.1_Silent_p.S380S	NM_194300	NP_919276	Q6ZRS4	CC129_HUMAN	coiled-coil domain containing 129	472											0						AGCTAGAGTCGGATGGGCCAG	0.502													49	151	---	---	---	---	capture	Silent	SNP	31682400	31682400	CCDC129	7	G	A	A	A	1	0	0	0	0	0	0	0	1	496	39	1	1	2738	240
EGFR	1956	broad.mit.edu	37	7	55210075	55210075	+	Missense_Mutation	SNP	T	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:55210075T>G	uc003tqk.2	+	2	431	c.185T>G	c.(184-186)CTT>CGT	p.L62R	EGFR_uc003tqh.2_Missense_Mutation_p.L62R|EGFR_uc003tqi.2_Missense_Mutation_p.L62R|EGFR_uc003tqj.2_Missense_Mutation_p.L62R|EGFR_uc010kzg.1_Missense_Mutation_p.L62R|EGFR_uc011kco.1_Missense_Mutation_p.L9R	NM_005228	NP_005219	P00533	EGFR_HUMAN	epidermal growth factor receptor isoform a	62	Extracellular (Potential).				activation of phospholipase A2 activity by calcium-mediated signaling|activation of phospholipase C activity|axon guidance|cell proliferation|cell-cell adhesion|negative regulation of apoptosis|negative regulation of epidermal growth factor receptor signaling pathway|ossification|positive regulation of catenin import into nucleus|positive regulation of cell migration|positive regulation of cyclin-dependent protein kinase activity involved in G1/S|positive regulation of epithelial cell proliferation|positive regulation of MAP kinase activity|positive regulation of nitric oxide biosynthetic process|positive regulation of phosphorylation|positive regulation of protein kinase B signaling cascade|protein autophosphorylation|protein insertion into membrane|regulation of nitric-oxide synthase activity|regulation of peptidyl-tyrosine phosphorylation|response to stress|response to UV-A	basolateral plasma membrane|endoplasmic reticulum membrane|endosome|extracellular space|Golgi membrane|integral to membrane|nuclear membrane|Shc-EGFR complex	actin filament binding|ATP binding|double-stranded DNA binding|epidermal growth factor receptor activity|identical protein binding|MAP/ERK kinase kinase activity|protein heterodimerization activity|protein phosphatase binding|receptor signaling protein tyrosine kinase activity	p.V30_R297>G(5)|p.L62R(1)		lung(9213)|central_nervous_system(103)|stomach(41)|upper_aerodigestive_tract(39)|prostate(32)|ovary(31)|thyroid(24)|breast(11)|peritoneum(9)|oesophagus(9)|salivary_gland(9)|large_intestine(8)|kidney(8)|urinary_tract(6)|skin(5)|adrenal_gland(5)|soft_tissue(4)|bone(3)|NS(2)|pancreas(2)|haematopoietic_and_lymphoid_tissue(2)|thymus(2)|liver(2)|eye(1)	9571	all_cancers(1;1.57e-46)|all_epithelial(1;5.62e-37)|Lung NSC(1;9.29e-25)|all_lung(1;4.39e-23)|Esophageal squamous(2;7.55e-08)|Breast(14;0.0318)		GBM - Glioblastoma multiforme(1;0)|all cancers(1;2.19e-314)|Lung(13;4.65e-05)|LUSC - Lung squamous cell carcinoma(13;0.000168)|STAD - Stomach adenocarcinoma(5;0.00164)|Epithelial(13;0.0607)		Cetuximab(DB00002)|Erlotinib(DB00530)|Gefitinib(DB00317)|Lapatinib(DB01259)|Lidocaine(DB00281)|Panitumumab(DB01269)|Trastuzumab(DB00072)	GAGGTGGTCCTTGGGAATTTG	0.408		8	A|O|Mis		glioma|NSCLC	NSCLC			Lung_Cancer_Familial_Clustering_of	TCGA GBM(3;<1E-08)|TSP Lung(4;<1E-08)			940	37	---	---	---	---	capture	Missense_Mutation	SNP	55210075	55210075	EGFR	7	T	G	G	G	1	0	0	0	0	1	0	0	0	728	56	4	4	4922	240
CALN1	83698	broad.mit.edu	37	7	71275350	71275350	+	Missense_Mutation	SNP	G	A	A	rs143545775		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:71275350G>A	uc003twa.3	-	5	1030	c.503C>T	c.(502-504)TCG>TTG	p.S168L	CALN1_uc003twb.3_Missense_Mutation_p.S210L|CALN1_uc003twc.3_Missense_Mutation_p.S168L	NM_001017440	NP_001017440	Q9BXU9	CABP8_HUMAN	calneuron 1 isoform 2	168	Cytoplasmic (Potential).					Golgi apparatus|integral to membrane|perinuclear region of cytoplasm|plasma membrane	calcium ion binding	p.S168L(1)		skin(1)	1		all_cancers(73;0.069)|Lung NSC(55;0.0658)|all_lung(88;0.0912)|all_epithelial(88;0.161)				GCAGTTCCCCGAGGTCTCATT	0.507													48	256	---	---	---	---	capture	Missense_Mutation	SNP	71275350	71275350	CALN1	7	G	A	A	A	1	0	0	0	0	1	0	0	0	481	37	1	1	2567	240
TYW1B	441250	broad.mit.edu	37	7	72093896	72093896	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:72093896C>T	uc011kej.1	-	15	1752	c.1593G>A	c.(1591-1593)GGG>GGA	p.G531G	TYW1B_uc011keh.1_Silent_p.G369G|TYW1B_uc011kei.1_Silent_p.G157G	NM_001145440	NP_001138912	Q6NUM6	TYW1B_HUMAN	tRNA-yW synthesizing protein 1 homolog B isoform	531					tRNA processing		4 iron, 4 sulfur cluster binding|FMN binding|iron ion binding|oxidoreductase activity				0						AGTCAGGATTCCCCAGGGACA	0.537													4	32	---	---	---	---	capture	Silent	SNP	72093896	72093896	TYW1B	7	C	T	T	T	1	0	0	0	0	0	0	0	1	379	30	2	2	16701	240
PIK3CG	5294	broad.mit.edu	37	7	106508826	106508826	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:106508826G>A	uc003vdv.3	+	2	905	c.820G>A	c.(820-822)GTC>ATC	p.V274I	PIK3CG_uc003vdu.2_Missense_Mutation_p.V274I|PIK3CG_uc003vdw.2_Missense_Mutation_p.V274I	NM_002649	NP_002640	P48736	PK3CG_HUMAN	phosphoinositide-3-kinase, catalytic, gamma	274					G-protein coupled receptor protein signaling pathway|phosphatidylinositol-mediated signaling|platelet activation	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity|protein binding			lung(16)|central_nervous_system(8)|breast(5)|pancreas(3)|stomach(2)|ovary(2)|upper_aerodigestive_tract(1)|skin(1)	38						TGTGCTGCGCGTCTGTGGCCG	0.542													5	117	---	---	---	---	capture	Missense_Mutation	SNP	106508826	106508826	PIK3CG	7	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	11819	240
PIK3CG	5294	broad.mit.edu	37	7	106509352	106509352	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:106509352C>T	uc003vdv.3	+	2	1431	c.1346C>T	c.(1345-1347)TCC>TTC	p.S449F	PIK3CG_uc003vdu.2_Missense_Mutation_p.S449F|PIK3CG_uc003vdw.2_Missense_Mutation_p.S449F	NM_002649	NP_002640	P48736	PK3CG_HUMAN	phosphoinositide-3-kinase, catalytic, gamma	449					G-protein coupled receptor protein signaling pathway|phosphatidylinositol-mediated signaling|platelet activation	phosphatidylinositol 3-kinase complex	1-phosphatidylinositol-3-kinase activity|ATP binding|phosphatidylinositol-4,5-bisphosphate 3-kinase activity|protein binding			lung(16)|central_nervous_system(8)|breast(5)|pancreas(3)|stomach(2)|ovary(2)|upper_aerodigestive_tract(1)|skin(1)	38						TCTGCAGAGTCCCCCAGTTCT	0.517													29	156	---	---	---	---	capture	Missense_Mutation	SNP	106509352	106509352	PIK3CG	7	C	T	T	T	1	0	0	0	0	1	0	0	0	390	30	2	2	11819	240
GCC1	79571	broad.mit.edu	37	7	127222169	127222169	+	Missense_Mutation	SNP	G	C	C			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:127222169G>C	uc003vma.2	-	2	2645	c.2227C>G	c.(2227-2229)CTC>GTC	p.L743V		NM_024523	NP_078799	Q96CN9	GCC1_HUMAN	Golgi coiled-coil protein 1	743	Potential.|GRIP.					Golgi membrane|plasma membrane	protein binding			ovary(2)	2						ATGGCTGTGAGAGTCTGCTGG	0.542													20	153	---	---	---	---	capture	Missense_Mutation	SNP	127222169	127222169	GCC1	7	G	C	C	C	1	0	0	0	0	1	0	0	0	429	33	4	4	6225	240
MGAM	8972	broad.mit.edu	37	7	141736628	141736628	+	Missense_Mutation	SNP	G	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:141736628G>T	uc003vwy.2	+	18	2136	c.2082G>T	c.(2080-2082)CAG>CAT	p.Q694H		NM_004668	NP_004659	O43451	MGA_HUMAN	maltase-glucoamylase	694	Lumenal (Potential).|Maltase.				polysaccharide digestion|starch catabolic process	apical plasma membrane|integral to membrane	carbohydrate binding|glucan 1,4-alpha-glucosidase activity|maltose alpha-glucosidase activity			ovary(2)	2	Melanoma(164;0.0272)				Acarbose(DB00284)|Miglitol(DB00491)|Voglibose(DB04878)	CCCAGGACCAGGATCCTGCCT	0.483													116	388	---	---	---	---	capture	Missense_Mutation	SNP	141736628	141736628	MGAM	7	G	T	T	T	1	0	0	0	0	1	0	0	0	451	35	4	4	9453	240
CNTNAP2	26047	broad.mit.edu	37	7	146825878	146825878	+	Missense_Mutation	SNP	G	A	A	rs145832489		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:146825878G>A	uc003weu.1	+	7	1549	c.1033G>A	c.(1033-1035)GTC>ATC	p.V345I		NM_014141	NP_054860	Q9UHC6	CNTP2_HUMAN	cell recognition molecule Caspr2 precursor	345	Laminin G-like 1.|Extracellular (Potential).				behavior|cell adhesion|clustering of voltage-gated potassium channels|limbic system development|neuron recognition|signal transduction|striatum development|superior temporal gyrus development|thalamus development|transmission of nerve impulse	axolemma|cell body fiber|dendrite|juxtaparanode region of axon|voltage-gated potassium channel complex	receptor binding			ovary(9)|central_nervous_system(1)|pancreas(1)	11	Melanoma(164;0.153)	all_cancers(3;3.51e-10)|all_epithelial(3;1.4e-05)|Myeloproliferative disorder(3;0.00452)|Lung NSC(3;0.0067)|all_lung(3;0.00794)	OV - Ovarian serous cystadenocarcinoma(82;0.0319)			CTACAATGGCGTCAACATTAC	0.413										HNSCC(39;0.1)			67	259	---	---	---	---	capture	Missense_Mutation	SNP	146825878	146825878	CNTNAP2	7	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	3612	240
SSPO	23145	broad.mit.edu	37	7	149517991	149517991	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr7:149517991G>A	uc010lpk.2	+	88	12334	c.12334G>A	c.(12334-12336)GTG>ATG	p.V4112M	SSPO_uc010lpm.1_5'Flank|SSPO_uc003wgg.2_5'Flank|SSPO_uc003wgh.2_5'Flank|SSPO_uc003wgi.1_5'Flank	NM_198455	NP_940857	A2VEC9	SSPO_HUMAN	SCO-spondin precursor	4112					cell adhesion	extracellular space	peptidase inhibitor activity				0	Melanoma(164;0.165)|Ovarian(565;0.177)		OV - Ovarian serous cystadenocarcinoma(82;0.00625)			TGGTGGCTGCGTGCCAATTGG	0.667													13	54	---	---	---	---	capture	Missense_Mutation	SNP	149517991	149517991	SSPO	7	G	A	A	A	1	0	0	0	0	1	0	0	0	520	40	1	1	15081	240
DOCK5	80005	broad.mit.edu	37	8	25159899	25159899	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:25159899G>A	uc003xeg.2	+	10	1042	c.905G>A	c.(904-906)CGC>CAC	p.R302H	DOCK5_uc010luf.1_RNA|DOCK5_uc003xeh.1_Missense_Mutation_p.R16H|DOCK5_uc003xef.2_Missense_Mutation_p.R302H	NM_024940	NP_079216	Q9H7D0	DOCK5_HUMAN	dedicator of cytokinesis 5	302						cytoplasm	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(3)	3		all_cancers(63;0.0361)|Ovarian(32;0.000711)|all_epithelial(46;0.0153)|Hepatocellular(4;0.115)|Prostate(55;0.13)|Breast(100;0.143)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0267)|Epithelial(17;1.07e-11)|Colorectal(74;0.0276)|COAD - Colon adenocarcinoma(73;0.0828)		CAGATTGTCCGCGTGGGCCAT	0.562													8	7	---	---	---	---	capture	Missense_Mutation	SNP	25159899	25159899	DOCK5	8	G	A	A	A	1	0	0	0	0	1	0	0	0	494	38	1	1	4646	240
DOCK5	80005	broad.mit.edu	37	8	25189802	25189802	+	Missense_Mutation	SNP	T	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:25189802T>A	uc003xeg.2	+	19	2076	c.1939T>A	c.(1939-1941)TCC>ACC	p.S647T	DOCK5_uc010luf.1_RNA|DOCK5_uc003xeh.1_Missense_Mutation_p.S361T|DOCK5_uc003xei.2_Missense_Mutation_p.S217T|DOCK5_uc003xej.2_RNA	NM_024940	NP_079216	Q9H7D0	DOCK5_HUMAN	dedicator of cytokinesis 5	647	DHR-1.					cytoplasm	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(3)	3		all_cancers(63;0.0361)|Ovarian(32;0.000711)|all_epithelial(46;0.0153)|Hepatocellular(4;0.115)|Prostate(55;0.13)|Breast(100;0.143)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0267)|Epithelial(17;1.07e-11)|Colorectal(74;0.0276)|COAD - Colon adenocarcinoma(73;0.0828)		GCGTTCCAACTCCCAGAACAT	0.378													35	77	---	---	---	---	capture	Missense_Mutation	SNP	25189802	25189802	DOCK5	8	T	A	A	A	1	0	0	0	0	1	0	0	0	702	54	4	4	4646	240
DOCK5	80005	broad.mit.edu	37	8	25265580	25265580	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:25265580C>T	uc003xeg.2	+	49	5312	c.5175C>T	c.(5173-5175)AGC>AGT	p.S1725S	PPP2R2A_uc003xek.2_Intron|DOCK5_uc003xej.2_RNA	NM_024940	NP_079216	Q9H7D0	DOCK5_HUMAN	dedicator of cytokinesis 5	1725						cytoplasm	GTP binding|GTPase binding|guanyl-nucleotide exchange factor activity			ovary(3)	3		all_cancers(63;0.0361)|Ovarian(32;0.000711)|all_epithelial(46;0.0153)|Hepatocellular(4;0.115)|Prostate(55;0.13)|Breast(100;0.143)		UCEC - Uterine corpus endometrioid carcinoma (27;0.0267)|Epithelial(17;1.07e-11)|Colorectal(74;0.0276)|COAD - Colon adenocarcinoma(73;0.0828)		AGGAGAACAGCGAGAACCGGA	0.498													4	17	---	---	---	---	capture	Silent	SNP	25265580	25265580	DOCK5	8	C	T	T	T	1	0	0	0	0	0	0	0	1	350	27	1	1	4646	240
PTK2B	2185	broad.mit.edu	37	8	27308400	27308400	+	Silent	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:27308400G>A	uc003xfn.1	+	30	3283	c.2475G>A	c.(2473-2475)GAG>GAA	p.E825E	PTK2B_uc003xfo.1_Silent_p.E825E|PTK2B_uc003xfp.1_Silent_p.E825E|PTK2B_uc003xfq.1_Silent_p.E783E|PTK2B_uc003xfs.1_Silent_p.E22E	NM_173174	NP_775266	Q14289	FAK2_HUMAN	PTK2B protein tyrosine kinase 2 beta isoform a	825	Interaction with TGFB1I1 (By similarity).				apoptosis|bone resorption|positive regulation of cell proliferation|signal complex assembly	cytosol	ATP binding|non-membrane spanning protein tyrosine kinase activity|signal transducer activity			lung(3)|ovary(1)|skin(1)	5		Ovarian(32;2.72e-05)		UCEC - Uterine corpus endometrioid carcinoma (27;0.023)|Epithelial(17;6.61e-10)|BRCA - Breast invasive adenocarcinoma(99;0.226)|Colorectal(74;0.229)		TCAGGCAGGAGGAGAAGTCCC	0.607													13	50	---	---	---	---	capture	Silent	SNP	27308400	27308400	PTK2B	8	G	A	A	A	1	0	0	0	0	0	0	0	1	451	35	2	2	12658	240
ADAM32	203102	broad.mit.edu	37	8	39111964	39111964	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:39111964C>T	uc003xmt.3	+	18	2179	c.1934C>T	c.(1933-1935)TCG>TTG	p.S645L	ADAM32_uc011lch.1_Missense_Mutation_p.S546L|ADAM32_uc003xmu.3_Missense_Mutation_p.S539L|ADAM32_uc003xmv.2_Missense_Mutation_p.S69L	NM_145004	NP_659441	Q8TC27	ADA32_HUMAN	a disintegrin and metalloprotease domain 32	645	EGF-like.|Extracellular (Potential).				proteolysis	integral to membrane	metalloendopeptidase activity|zinc ion binding			ovary(1)|lung(1)|kidney(1)	3		all_cancers(7;3e-05)|all_lung(54;0.00187)|Hepatocellular(245;0.00745)|Lung NSC(58;0.00771)|Breast(189;0.0503)	LUSC - Lung squamous cell carcinoma(45;6.2e-07)|Colorectal(1;0.00699)|READ - Rectum adenocarcinoma(1;0.146)			TGCCATTGTTCGCCAGGCTAT	0.363													4	19	---	---	---	---	capture	Missense_Mutation	SNP	39111964	39111964	ADAM32	8	C	T	T	T	1	0	0	0	0	1	0	0	0	403	31	1	1	249	240
JPH1	56704	broad.mit.edu	37	8	75227467	75227467	+	Silent	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:75227467C>T	uc003yae.2	-	2	808	c.768G>A	c.(766-768)ACG>ACA	p.T256T	JPH1_uc003yaf.2_Silent_p.T256T|JPH1_uc003yag.1_Silent_p.T120T	NM_020647	NP_065698	Q9HDC5	JPH1_HUMAN	junctophilin 1	256	Cytoplasmic (Potential).|Ser-rich.				calcium ion transport into cytosol|regulation of ryanodine-sensitive calcium-release channel activity	integral to membrane|junctional membrane complex|junctional sarcoplasmic reticulum membrane|plasma membrane				ovary(1)	1	Breast(64;0.00576)		BRCA - Breast invasive adenocarcinoma(89;0.0499)|Epithelial(68;0.0728)|all cancers(69;0.176)			CAAAGCTGATCGTGGAGTTGG	0.557													55	87	---	---	---	---	capture	Silent	SNP	75227467	75227467	JPH1	8	C	T	T	T	1	0	0	0	0	0	0	0	1	392	31	1	1	7883	240
TM7SF4	81501	broad.mit.edu	37	8	105361318	105361318	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr8:105361318C>T	uc003ylx.1	+	2	587	c.538C>T	c.(538-540)CAT>TAT	p.H180Y		NM_030788	NP_110415	Q9H295	TM7S4_HUMAN	dendritic cell-specific transmembrane protein	180					osteoclast differentiation	cell surface|integral to membrane|plasma membrane				pancreas(2)|large_intestine(1)|ovary(1)	4			OV - Ovarian serous cystadenocarcinoma(57;1.61e-06)|STAD - Stomach adenocarcinoma(118;0.229)			CAGTCCCAGCCATGTCCTGGA	0.507													74	126	---	---	---	---	capture	Missense_Mutation	SNP	105361318	105361318	TM7SF4	8	C	T	T	T	1	0	0	0	0	1	0	0	0	273	21	2	2	15861	240
CNTNAP3	79937	broad.mit.edu	37	9	39176040	39176040	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:39176040C>T	uc004abi.2	-	7	1216	c.977G>A	c.(976-978)CGT>CAT	p.R326H	CNTNAP3_uc004abj.2_Missense_Mutation_p.R326H|CNTNAP3_uc011lqr.1_RNA|CNTNAP3_uc004abk.1_Missense_Mutation_p.R326H|CNTNAP3_uc011lqs.1_Missense_Mutation_p.R326H|CNTNAP3_uc004abl.1_Missense_Mutation_p.R238H	NM_033655	NP_387504	Q9BZ76	CNTP3_HUMAN	cell recognition molecule CASPR3 precursor	326	Extracellular (Potential).|Laminin G-like 1.				cell adhesion|cell recognition|signal transduction	extracellular region|integral to membrane|plasma membrane	receptor binding			ovary(1)	1				GBM - Glioblastoma multiforme(29;0.02)|Lung(182;0.0681)		AAAGCTTTTACGTCTGAATGC	0.388													18	199	---	---	---	---	capture	Missense_Mutation	SNP	39176040	39176040	CNTNAP3	9	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	3613	240
FOXD4L5	653427	broad.mit.edu	37	9	70177155	70177155	+	Missense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:70177155C>T	uc010moc.2	-	1	1661	c.829G>A	c.(829-831)GTC>ATC	p.V277I		NM_001126334	NP_001119806	Q5VV16	FX4L5_HUMAN	forkhead box D4-like 5	277					axon extension involved in axon guidance|cartilage development|dichotomous subdivision of terminal units involved in ureteric bud branching|embryo development|enteric nervous system development|iridophore differentiation|lateral line nerve glial cell development|melanocyte differentiation|neural crest cell migration|pattern specification process|peripheral nervous system development|positive regulation of BMP signaling pathway|positive regulation of kidney development|positive regulation of transcription from RNA polymerase II promoter|regulation of sequence-specific DNA binding transcription factor activity|sympathetic nervous system development	transcription factor complex	DNA bending activity|double-stranded DNA binding|promoter binding|sequence-specific DNA binding|sequence-specific enhancer binding RNA polymerase II transcription factor activity|specific RNA polymerase II transcription factor activity|specific transcriptional repressor activity|transcription activator activity|transcription factor binding				0						CCGGCATAGACGGGGGCCGAG	0.687													12	105	---	---	---	---	capture	Missense_Mutation	SNP	70177155	70177155	FOXD4L5	9	C	T	T	T	1	0	0	0	0	1	0	0	0	247	19	1	1	5946	240
PAPPA	5069	broad.mit.edu	37	9	118949533	118949533	+	Missense_Mutation	SNP	C	G	G	rs141909455		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:118949533C>G	uc004bjn.2	+	2	897	c.516C>G	c.(514-516)TTC>TTG	p.F172L	PAPPA_uc011lxp.1_5'UTR|PAPPA_uc011lxq.1_5'UTR	NM_002581	NP_002572	Q13219	PAPP1_HUMAN	pregnancy-associated plasma protein A	172					cell differentiation|female pregnancy	cytoplasm|extracellular region|membrane	metalloendopeptidase activity|zinc ion binding			ovary(4)|skin(4)|pancreas(1)	9						GCTACTTTTTCTCCTTGAAGA	0.537													3	86	---	---	---	---	capture	Missense_Mutation	SNP	118949533	118949533	PAPPA	9	C	G	G	G	1	0	0	0	0	1	0	0	0	415	32	4	4	11336	240
NUP214	8021	broad.mit.edu	37	9	134016058	134016058	+	Nonsense_Mutation	SNP	C	T	T			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr9:134016058C>T	uc004cag.2	+	11	1366	c.1255C>T	c.(1255-1257)CGA>TGA	p.R419*	NUP214_uc004cah.2_Nonsense_Mutation_p.R419*|NUP214_uc004caf.1_Nonsense_Mutation_p.R419*	NM_005085	NP_005076	P35658	NU214_HUMAN	nucleoporin 214kDa	419					carbohydrate metabolic process|glucose transport|mRNA metabolic process|protein export from nucleus|regulation of glucose transport|transmembrane transport|viral reproduction	cytosol|nuclear pore|nucleoplasm	protein binding			breast(7)|lung(3)|skin(3)|ovary(2)|central_nervous_system(1)	16	all_hematologic(7;0.0028)	Myeloproliferative disorder(178;0.204)		OV - Ovarian serous cystadenocarcinoma(145;3.42e-05)|Epithelial(140;0.000256)		AACACCAGAGCGACTTTCATT	0.433			T	DEK|SET|ABL1	AML|T-ALL								44	61	---	---	---	---	capture	Nonsense_Mutation	SNP	134016058	134016058	NUP214	9	C	T	T	T	1	0	0	0	0	0	1	0	0	347	27	5	1	10669	240
DMD	1756	broad.mit.edu	37	X	32486813	32486813	+	Silent	SNP	A	G	G			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:32486813A>G	uc004dda.1	-	23	3208	c.2964T>C	c.(2962-2964)TCT>TCC	p.S988S	DMD_uc004dcz.2_Silent_p.S865S|DMD_uc004dcy.1_Silent_p.S984S|DMD_uc004ddb.1_Silent_p.S980S|DMD_uc010ngo.1_Intron	NM_004006	NP_003997	P11532	DMD_HUMAN	dystrophin Dp427m isoform	988	Spectrin 6.				muscle filament sliding|peptide biosynthetic process	cell surface|costamere|cytoskeleton|cytosol|dystrophin-associated glycoprotein complex|sarcolemma	actin binding|dystroglycan binding|nitric-oxide synthase binding|protein binding|structural constituent of cytoskeleton|structural constituent of muscle|zinc ion binding			ovary(3)|pancreas(2)|large_intestine(1)	6		all_cancers(2;1.22e-16)|Acute lymphoblastic leukemia(2;4.65e-06)|all_hematologic(2;0.00108)|all_epithelial(3;0.00626)|all_neural(2;0.0189)|all_lung(315;0.182)|Glioma(3;0.203)				GCTCTTGCAGAGAACTTTGTA	0.333													6	41	---	---	---	---	capture	Silent	SNP	32486813	32486813	DMD	23	A	G	G	G	1	0	0	0	0	0	0	0	1	132	11	3	3	4538	240
RPGR	6103	broad.mit.edu	37	X	38182768	38182768	+	Missense_Mutation	SNP	G	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:38182768G>A	uc004ded.1	-	2	206	c.38C>T	c.(37-39)GCT>GTT	p.A13V	RPGR_uc004deb.2_Missense_Mutation_p.A13V|RPGR_uc004dea.2_RNA|RPGR_uc004dec.2_RNA	NM_001034853	NP_001030025	Q92834	RPGR_HUMAN	retinitis pigmentosa GTPase regulator isoform C	13					intracellular protein transport|response to stimulus|visual perception	Golgi apparatus|photoreceptor outer segment	guanyl-nucleotide exchange factor activity|protein binding			ovary(1)	1						TGTAAACACAGCACCCGAATC	0.318													3	59	---	---	---	---	capture	Missense_Mutation	SNP	38182768	38182768	RPGR	23	G	A	A	A	1	0	0	0	0	1	0	0	0	442	34	2	2	13440	240
IL1RAPL2	26280	broad.mit.edu	37	X	105011591	105011591	+	Missense_Mutation	SNP	C	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:105011591C>A	uc004elz.1	+	11	2754	c.1998C>A	c.(1996-1998)CAC>CAA	p.H666Q		NM_017416	NP_059112	Q9NP60	IRPL2_HUMAN	interleukin 1 receptor accessory protein-like 2	666	Cytoplasmic (Potential).				central nervous system development|innate immune response	integral to membrane	interleukin-1, Type II, blocking receptor activity			breast(2)|ovary(1)	3						AGGAATTTCACAGGAACAGTT	0.428													90	35	---	---	---	---	capture	Missense_Mutation	SNP	105011591	105011591	IL1RAPL2	23	C	A	A	A	1	0	0	0	0	1	0	0	0	220	17	4	4	7585	240
COL4A5	1287	broad.mit.edu	37	X	107841977	107841977	+	Missense_Mutation	SNP	G	A	A	rs104886135		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:107841977G>A	uc004enz.1	+	25	2027	c.1825G>A	c.(1825-1827)GGT>AGT	p.G609S	COL4A5_uc011mso.1_Missense_Mutation_p.G609S|COL4A5_uc004eob.1_Missense_Mutation_p.G217S	NM_033380	NP_203699	P29400	CO4A5_HUMAN	type IV collagen alpha 5 isoform 2 precursor	609	Triple-helical region.		G -> V (in APSX; juvenile type).|G -> R (in APSX; juvenile type).		axon guidance	collagen type IV	extracellular matrix structural constituent|protein binding			ovary(3)|central_nervous_system(1)	4						TGGGAACCCAGGTTTACCAGG	0.483									Alport_syndrome_with_Diffuse_Leiomyomatosis				5	148	---	---	---	---	capture	Missense_Mutation	SNP	107841977	107841977	COL4A5	23	G	A	A	A	1	0	0	0	0	1	0	0	0	455	35	2	2	3659	240
FAM48A	55578	broad.mit.edu	37	13	37583874	37583876	+	In_Frame_Del	DEL	GAT	-	-	rs149036783		TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr13:37583874_37583876delGAT	uc001uwg.2	-	26	2521_2523	c.2273_2275delATC	c.(2272-2277)CATCGG>CGG	p.H758del	FAM48A_uc010abt.2_In_Frame_Del_p.724_725SS>S|FAM48A_uc001uwh.2_In_Frame_Del_p.724_725SS>S|FAM48A_uc001uwi.2_In_Frame_Del_p.723_724SS>S|FAM48A_uc001uwj.2_In_Frame_Del_p.724_725SS>S|FAM48A_uc001uwk.2_In_Frame_Del_p.802_803SS>S|FAM48A_uc001uwd.2_In_Frame_Del_p.210_211SS>S|FAM48A_uc001uwe.2_In_Frame_Del_p.H242del|FAM48A_uc001uwf.2_In_Frame_Del_p.H324del	NM_001014286	NP_001014308	Q8NEM7	FA48A_HUMAN	family with sequence similarity 48, member A	758					autophagy|gastrulation	SAGA-type complex	protein binding				0		Lung NSC(96;2.09e-06)|Breast(139;0.014)|Lung SC(185;0.0548)|Prostate(109;0.0959)		all cancers(112;6.06e-07)|Epithelial(112;1.87e-05)|OV - Ovarian serous cystadenocarcinoma(117;0.00794)|BRCA - Breast invasive adenocarcinoma(63;0.0128)|GBM - Glioblastoma multiforme(144;0.0477)		CCTGTATGCCGATGATGATGTAG	0.424													9	155	---	---	---	---	capture_indel	In_Frame_Del	DEL	37583874	37583876	FAM48A	13	GAT	-	-	-	1	0	1	0	1	0	0	0	0	481	37	5	5	5520	240
RB1	5925	broad.mit.edu	37	13	48941711	48941711	+	Frame_Shift_Del	DEL	A	-	-			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr13:48941711delA	uc001vcb.2	+	10	1187	c.1021delA	c.(1021-1023)AAAfs	p.K341fs	RB1_uc010act.1_Frame_Shift_Del_p.K42fs	NM_000321	NP_000312	P06400	RB_HUMAN	retinoblastoma 1	341					androgen receptor signaling pathway|cell cycle arrest|chromatin remodeling|G1 phase of mitotic cell cycle|interspecies interaction between organisms|maintenance of mitotic sister chromatid cohesion|mitotic cell cycle G1/S transition checkpoint|myoblast differentiation|negative regulation of cell growth|negative regulation of protein kinase activity|negative regulation of S phase of mitotic cell cycle|negative regulation of sequence-specific DNA binding transcription factor activity|positive regulation of mitotic metaphase/anaphase transition|protein localization to chromosome, centromeric region|Ras protein signal transduction|regulation of centromere complex assembly|regulation of cohesin localization to chromatin|regulation of lipid kinase activity|regulation of transcription involved in G1/S phase of mitotic cell cycle|S phase of mitotic cell cycle|sister chromatid biorientation	chromatin|PML body|Rb-E2F complex|SWI/SNF complex	androgen receptor binding|DNA binding|kinase binding|phosphoprotein binding|sequence-specific DNA binding transcription factor activity|transcription coactivator activity|transcription factor binding|ubiquitin protein ligase binding	p.?(6)|p.D340fs*5(1)		lung(94)|eye(89)|central_nervous_system(47)|bone(22)|breast(21)|urinary_tract(17)|haematopoietic_and_lymphoid_tissue(14)|ovary(10)|prostate(9)|soft_tissue(8)|skin(7)|endometrium(5)|cervix(3)|liver(3)|salivary_gland(2)|stomach(2)|oesophagus(1)|adrenal_gland(1)|kidney(1)|gastrointestinal_tract_(site_indeterminate)(1)|pituitary(1)	358		all_cancers(8;6.9e-71)|all_epithelial(8;4.61e-22)|Acute lymphoblastic leukemia(8;1.1e-21)|all_hematologic(8;2.3e-21)|all_lung(13;1.51e-09)|Lung NSC(96;7.03e-07)|Breast(56;1.53e-05)|Prostate(109;0.000493)|Myeloproliferative disorder(33;0.0179)|Hepatocellular(98;0.0207)|all_neural(104;0.0227)|Glioma(44;0.0286)|Lung SC(185;0.0301)		GBM - Glioblastoma multiforme(2;9.98e-18)|LUSC - Lung squamous cell carcinoma(3;0.013)	Insulin Glargine recombinant(DB00047)|Insulin Lyspro recombinant(DB00046)|Insulin recombinant(DB00030)|Insulin, porcine(DB00071)	GGATCATGATAAAACTCTTCA	0.279		6	D|Mis|N|F|S		retinoblastoma|sarcoma|breast|small cell lung	retinoblastoma|sarcoma|breast|small cell lung			Hereditary_Retinoblastoma	TCGA GBM(7;6.82e-08)|TSP Lung(12;0.097)|TCGA Ovarian(6;0.080)			28	62	---	---	---	---	capture_indel	Frame_Shift_Del	DEL	48941711	48941711	RB1	13	A	-	-	-	1	0	1	0	1	0	0	0	0	169	13	5	5	12993	240
BPTF	2186	broad.mit.edu	37	17	65822381	65822383	+	In_Frame_Del	DEL	GAC	-	-			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr17:65822381_65822383delGAC	uc002jgf.2	+	1	602_604	c.541_543delGAC	c.(541-543)GACdel	p.D185del	BPTF_uc002jge.2_In_Frame_Del_p.D185del|BPTF_uc010wqm.1_In_Frame_Del_p.D185del	NM_182641	NP_872579	Q12830	BPTF_HUMAN	bromodomain PHD finger transcription factor	185	Asp-rich.				brain development|chromatin remodeling|negative regulation of transcription from RNA polymerase II promoter|positive regulation of transcription, DNA-dependent|transcription, DNA-dependent	cytoplasm|NURF complex	sequence-specific DNA binding|transcription factor binding|zinc ion binding			ovary(2)|skin(2)	4	all_cancers(12;6e-11)		BRCA - Breast invasive adenocarcinoma(8;7.48e-08)|Colorectal(3;0.0984)|LUSC - Lung squamous cell carcinoma(166;0.24)			GGAGATGGAAGACGACGACGACG	0.571													7	69	---	---	---	---	capture_indel	In_Frame_Del	DEL	65822381	65822383	BPTF	17	GAC	-	-	-	1	0	1	0	1	0	0	0	0	429	33	5	5	1483	240
TBC1D23	55773	broad.mit.edu	37	3	100002647	100002648	+	Frame_Shift_Ins	INS	-	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chr3:100002647_100002648insA	uc003dtt.2	+	4	645_646	c.468_469insA	c.(466-471)TACATTfs	p.Y156fs	TBC1D23_uc003dts.2_Frame_Shift_Ins_p.Y156fs	NM_018309	NP_060779	Q9NUY8	TBC23_HUMAN	TBC1 domain family, member 23	156_157	Rab-GAP TBC.					intracellular	Rab GTPase activator activity			ovary(1)|liver(1)	2						TGAATAAGTACATTCCCAGGTA	0.381													43	81	---	---	---	---	capture_indel	Frame_Shift_Ins	INS	100002647	100002648	TBC1D23	3	-	A	A	A	1	0	1	1	0	0	0	0	0	220	17	5	5	15501	240
BHLHB9	80823	broad.mit.edu	37	X	102004542	102004543	+	Frame_Shift_Ins	INS	-	A	A			TCGA-32-2632-01	TCGA-32-2632-01									Unknown	Unspecified	Unspecified				Unspecified	g.chrX:102004542_102004543insA	uc010nog.2	+	4	1190_1191	c.619_620insA	c.(619-621)GAAfs	p.E207fs	BHLHB9_uc011mrq.1_Frame_Shift_Ins_p.E207fs|BHLHB9_uc011mrr.1_Frame_Shift_Ins_p.E207fs|BHLHB9_uc011mrs.1_Frame_Shift_Ins_p.E207fs|BHLHB9_uc011mrt.1_Frame_Shift_Ins_p.E207fs|BHLHB9_uc004ejo.2_Frame_Shift_Ins_p.E207fs|BHLHB9_uc011mru.1_Frame_Shift_Ins_p.E207fs|BHLHB9_uc011mrv.1_Frame_Shift_Ins_p.E207fs	NM_001142526	NP_001135998	Q6PI77	BHLH9_HUMAN	basic helix-loop-helix domain containing, class	207						cytoplasm|nucleus	binding			ovary(2)	2						TGAAATTAATGAAAAAAATAGG	0.450													140	64	---	---	---	---	capture_indel	Frame_Shift_Ins	INS	102004542	102004543	BHLHB9	23	-	A	A	A	1	0	1	1	0	0	0	0	0	585	45	5	5	1408	240
